Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

EIF3F Rabbit pAb (A7023)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - EIF3F Rabbit pAb (A7023)

Western blot analysis of lysates from HeLa cells, using EIF3F Rabbit pAb (A7023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunohistochemistry - EIF3F Rabbit pAb (A7023)

Immunohistochemistry analysis of EIF3F in paraffin-embedded Human colon tissue using EIF3F Rabbit pAb (A7023) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - EIF3F Rabbit pAb (A7023)

Immunohistochemistry analysis of EIF3F in paraffin-embedded Human pancreas tissue using EIF3F Rabbit pAb (A7023) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - EIF3F Rabbit pAb (A7023)

Immunohistochemistry analysis of EIF3F in paraffin-embedded Rat brain tissue using EIF3F Rabbit pAb (A7023) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - EIF3F Rabbit pAb (A7023)

Immunohistochemistry analysis of EIF3F in paraffin-embedded Mouse spleen tissue using EIF3F Rabbit pAb (A7023) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - EIF3F Rabbit pAb (A7023)

Immunofluorescence analysis of NIH/3T3 cells using EIF3F Rabbit pAb (A7023) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - EIF3F Rabbit pAb (A7023)

Immunofluorescence analysis of PC-12 cells using EIF3F Rabbit pAb (A7023) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - EIF3F Rabbit pAb (A7023)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg EIF3F antibody (A7023). Western blot was performed from the immunoprecipitate using EIF3F antibody (A7023) at a dilution of 1:1000.

You may also interested in:

Overview

Product name EIF3F Rabbit pAb
Catalog No. A7023
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables deubiquitinase activity and identical protein binding activity. Contributes to translation initiation factor activity. Involved in IRES-dependent viral translational initiation; protein deubiquitination; and translational initiation. Located in membrane. Part of eukaryotic translation initiation factor 3 complex. Implicated in autosomal recessive non-syndromic intellectual disability.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 88-357 of human EIF3F (NP_003745.1).
Sequence GGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL
Gene ID 8665
Swiss prot O00303
Synonyms MRT67; EIF3S5; eIF3-p47; EIF3F
Calculated MW 38kDa
Observed MW 38kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa
Cellular location Cytoplasm
Customer validation

WB (Homo sapiens, Mus musculus)

IP (Homo sapiens)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

EIF3F Rabbit pAb images

ABclonal:Western blot - EIF3F Rabbit pAb (A7023)}

Western blot - EIF3F Rabbit pAb (A7023)

Western blot analysis of lysates from HeLa cells, using EIF3F Rabbit pAb (A7023) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
ABclonal:Immunohistochemistry - EIF3F Rabbit pAb (A7023)}

Immunohistochemistry - EIF3F Rabbit pAb (A7023)

Immunohistochemistry analysis of EIF3F in paraffin-embedded Human colon tissue using EIF3F Rabbit pAb (A7023) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - EIF3F Rabbit pAb (A7023)}

Immunohistochemistry - EIF3F Rabbit pAb (A7023)

Immunohistochemistry analysis of EIF3F in paraffin-embedded Human pancreas tissue using EIF3F Rabbit pAb (A7023) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - EIF3F Rabbit pAb (A7023)}

Immunohistochemistry - EIF3F Rabbit pAb (A7023)

Immunohistochemistry analysis of EIF3F in paraffin-embedded Rat brain tissue using EIF3F Rabbit pAb (A7023) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - EIF3F Rabbit pAb (A7023)}

Immunohistochemistry - EIF3F Rabbit pAb (A7023)

Immunohistochemistry analysis of EIF3F in paraffin-embedded Mouse spleen tissue using EIF3F Rabbit pAb (A7023) at a dilution of  1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - EIF3F Rabbit pAb (A7023)}

Immunofluorescence - EIF3F Rabbit pAb (A7023)

Immunofluorescence analysis of NIH/3T3 cells using EIF3F Rabbit pAb (A7023) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - EIF3F Rabbit pAb (A7023)}

Immunofluorescence - EIF3F Rabbit pAb (A7023)

Immunofluorescence analysis of PC-12 cells using EIF3F Rabbit pAb (A7023) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - EIF3F Rabbit pAb (A7023)}

Immunoprecipitation - EIF3F Rabbit pAb (A7023)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg EIF3F antibody (A7023). Western blot was performed from the immunoprecipitate using EIF3F antibody (A7023) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A7023 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EIF3F. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EIF3F. (Distance between topics and target gene indicate popularity.) EIF3F

* Data provided by citexs.com, for reference only.

Publishing research using A7023? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order