Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

EIF1 Rabbit pAb (A10785)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - EIF1 Rabbit pAb (A10785)

Western blot analysis of extracts of various cell lines, using EIF1 antibody (A10785) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name EIF1 Rabbit pAb
Catalog No. A10785
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables RNA binding activity. Involved in regulation of translational initiation. Located in cytoplasm and nucleus.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of human EIF1 (NP_005792.1).
Sequence MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
Gene ID 10209
Swiss prot P41567
Synonyms A121; ISO1; SUI1; EIF-1; EIF1A; EIF1
Calculated MW 13kDa
Observed MW 13kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, Mouse liver
Cellular location cytoplasm, nucleus

Research Area

EIF1 Rabbit pAb images

ABclonal:Western blot - EIF1 Rabbit pAb (A10785)}

Western blot - EIF1 Rabbit pAb (A10785)

Western blot analysis of extracts of various cell lines, using EIF1 antibody (A10785) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A10785 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EIF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EIF1. (Distance between topics and target gene indicate popularity.) EIF1

* Data provided by citexs.com, for reference only.

Publishing research using A10785? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order