Publications (3) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse
Product name | Dot1L/KMT4 Rabbit mAb |
---|---|
Catalog No. | A12329 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0688 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dot1L/KMT4 (NP_115871.1). |
---|---|
Sequence | MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNT |
Gene ID | 84444 |
Swiss prot | Q8TEK3 |
Synonyms | DOT1; KMT4; Dot1L/KMT4 |
Calculated MW | 165kDa |
Observed MW | 170kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | Testing results |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunoprecipitation |
Positive samples | HeLa, U-87MG, Mouse brain |
Cellular location | Nucleus |
Customer validation | WB (Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A12329 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on DOT1L. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to DOT1L. (Distance between topics and target gene indicate popularity.) DOT1L
* Data provided by citexs.com, for reference only.
Publishing research using A12329? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.