Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Dot1L/KMT4 Rabbit mAb (A12329)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Dot1L/KMT4 Rabbit mAb (A12329)

Western blot analysis of various lysates using Dot1L/KMT4 Rabbit mAb (A12329) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - Dot1L/KMT4 Rabbit mAb (A12329)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg Dot1L/KMT4 Rabbit mAb (A12329). Western blot was performed from the immunoprecipitate using Dot1L/KMT4 Rabbit mAb (A12329) at a dilution of 1:1000.

You may also interested in:

Overview

Product name Dot1L/KMT4 Rabbit mAb
Catalog No. A12329
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0688

Background

The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dot1L/KMT4 (NP_115871.1).
Sequence MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNT
Gene ID 84444
Swiss prot Q8TEK3
Synonyms DOT1; KMT4; Dot1L/KMT4
Calculated MW 165kDa
Observed MW 170kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples HeLa, U-87MG, Mouse brain
Cellular location Nucleus
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Dot1L/KMT4 Rabbit mAb images

ABclonal:Western blot - Dot1L/KMT4 Rabbit mAb (A12329)}

Western blot - Dot1L/KMT4 Rabbit mAb (A12329)

Western blot analysis of various lysates using Dot1L/KMT4 Rabbit mAb (A12329) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunoprecipitation - Dot1L/KMT4 Rabbit mAb (A12329)}

Immunoprecipitation - Dot1L/KMT4 Rabbit mAb (A12329)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg Dot1L/KMT4 Rabbit mAb (A12329). Western blot was performed from the immunoprecipitate using Dot1L/KMT4 Rabbit mAb (A12329) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A12329 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DOT1L. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DOT1L. (Distance between topics and target gene indicate popularity.) DOT1L

* Data provided by citexs.com, for reference only.

Publishing research using A12329? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order