Product Type > Antibodies > Primary Antibodies > Methyl-specific Antibodies

DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Western blot analysis of various lysates, using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Dot Blot - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Dot-blot analysis of all sorts of peptides using DiMethyl-Histone H4-K20 Rabbit mAb antibody (A22269) at 1:1000 dilution.

ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded rat colon tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded human small intestine tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded human colon carcinoma tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded mouse brain tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded mouse liver tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded human breast cancer tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

You may also interested in:

Overview

Product name DiMethyl-Histone H4-K20 Rabbit mAb
Catalog No. A22269
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC55059

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.

Immunogen information

Immunogen A synthetic dimethylated peptide around K20 of human Histone H4 (NP_003539.1).
Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Gene ID 8359
Swiss prot P62805
Synonyms H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20
Calculated MW 11kDa
Observed MW 11kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications Testing results
IHC-P HumanMouseRat
WB HumanMouseRat
Recommended dilution
  • DB 1:500 - 1:1000
  • WB 1:500 - 1:1000
  • IHC-P 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293F, NIH/3T3, C6
Cellular location Chromosome, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DiMethyl-Histone H4-K20 Rabbit mAb images

ABclonal:Western blot - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)}

Western blot - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Western blot analysis of various lysates, using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
ABclonal:Dot Blot - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)}

Dot Blot - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Dot-blot analysis of all sorts of peptides using DiMethyl-Histone H4-K20 Rabbit mAb antibody (A22269) at 1:1000 dilution.
ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)}

Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded rat colon tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)}

Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded human small intestine tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)}

Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded human colon carcinoma tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)}

Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded mouse brain tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)}

Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded mouse liver tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)}

Immunohistochemistry - DiMethyl-Histone H4-K20 Rabbit mAb (A22269)

Immunohistochemistry analysis of DiMethyl-Histone H4-K20 in paraffin-embedded human breast cancer tissue using DiMethyl-Histone H4-K20 Rabbit mAb (A22269) at a dilution of 1:1500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Inquire About This Product

Submit your question about A22269 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Histone H4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Histone H4. (Distance between topics and target gene indicate popularity.) Histone H4

* Data provided by citexs.com, for reference only.

Publishing research using A22269? Please let us know so that we can cite the reference in this datasheet.

Antibodies (33)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order