Product Type > Antibodies > Primary Antibodies > Methyl-specific Antibodies

DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Reviews (3) Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

ABclonal:Western blot - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Western blot analysis of various lysates, using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Dot Blot - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Dot-blot analysis of all sorts of methylation peptides using DiMethyl-Histone H3-K27 antibody (A2362) at 1:1000 dilution.

ABclonal:Immunohistochemistry - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Immunohistochemistry analysis of DiMethyl-Histone H3-K27 in paraffin-embedded human colon tissue using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Immunohistochemistry analysis of DiMethyl-Histone H3-K27 in paraffin-embedded mouse spleen tissue using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Immunohistochemistry analysis of DiMethyl-Histone H3-K27 in paraffin-embedded rat lung tissue using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Immunofluorescence analysis of HeLa cells using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Chromatin Immunoprecipitation - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Chromatin immunoprecipitation analysis of extracts of 293 cell line, using DiMethyl-Histone H3-K27 antibody (A2362) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Review
ABclonal: review for DiMethyl-Histone H3-K27 Rabbit pAb(A2362)
Review
ABclonal: review for DiMethyl-Histone H3-K27 Rabbit pAb(A2362)
Review
ABclonal: review for DiMethyl-Histone H3-K27 Rabbit pAb(A2362)

You may also interested in:

Overview

Product name DiMethyl-Histone H3-K27 Rabbit pAb
Catalog No. A2362
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1).
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Gene ID 82908350
Swiss prot Q16695P68431
Synonyms H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K27
Calculated MW 16kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat, Other (Wide Range Predicted)
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • DB 1:500 - 1:1000
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • ChIP 5μg antibody for 5μg-10μg of Chromatin
  • ChIP-seq 1:20 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, NIH/3T3, C6, H3
Cellular location Chromosome, Nucleus
Customer validation

WB (293FT,PC9, HeLaHomo sapiens)

IF (Goat sperm)

ChIP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

DiMethyl-Histone H3-K27 Rabbit pAb images

ABclonal:Western blot - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)}

Western blot - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Western blot analysis of various lysates, using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Dot Blot - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)}

Dot Blot - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Dot-blot analysis of all sorts of methylation peptides using DiMethyl-Histone H3-K27 antibody (A2362) at 1:1000 dilution.
ABclonal:Immunohistochemistry - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)}

Immunohistochemistry - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Immunohistochemistry analysis of DiMethyl-Histone H3-K27 in paraffin-embedded human colon tissue using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)}

Immunohistochemistry - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Immunohistochemistry analysis of DiMethyl-Histone H3-K27 in paraffin-embedded mouse spleen tissue using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)}

Immunohistochemistry - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Immunohistochemistry analysis of DiMethyl-Histone H3-K27 in paraffin-embedded rat lung tissue using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)}

Immunofluorescence - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Immunofluorescence analysis of HeLa cells using DiMethyl-Histone H3-K27 Rabbit pAb (A2362) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Chromatin Immunoprecipitation - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)}

Chromatin Immunoprecipitation - DiMethyl-Histone H3-K27 Rabbit pAb (A2362)

Chromatin immunoprecipitation analysis of extracts of 293 cell line, using DiMethyl-Histone H3-K27 antibody (A2362) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Submit an review for A2362

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2362 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on H3-4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to H3-4. (Distance between topics and target gene indicate popularity.) H3-4

* Data provided by citexs.com, for reference only.

Publishing research using A2362? Please let us know so that we can cite the reference in this datasheet.

Antibodies (114)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order