Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Desmin Rabbit pAb (A0699)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Desmin Rabbit pAb (A0699)

Western blot analysis of lysates from C2C12 cells using Desmin Rabbit pAb(A0699) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:1s.

ABclonal:Immunohistochemistry - Desmin Rabbit pAb (A0699)

Immunohistochemistry analysis of Desmin in paraffin-embedded human colon using Desminmin Rabbit pAb (A0699) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Desmin Rabbit pAb (A0699)

Immunohistochemistry analysis of Desmin in paraffin-embedded mouse lung using Desminmin Rabbit pAb (A0699) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Desmin Rabbit pAb (A0699)

Immunofluorescence analysis of paraffin-embedded rat heart using Desminmin Rabbit pAb (A0699) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Desmin Rabbit pAb
Catalog No. A0699
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human Desmin (NP_001918.3).
Sequence MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLD
Gene ID 1674
Swiss prot P17661
Synonyms CSM1; CSM2; CDCD3; LGMD1D; LGMD1E; LGMD2R; Desmin
Calculated MW 54kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples C2C12
Cellular location Cell membrane, Cytoplasm, sarcolemma
Customer validation

WB (Triticum aestivum L., AgnusDei, Rattus norvegicus)

IHC (Mus musculus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Desmin Rabbit pAb images

ABclonal:Western blot - Desmin Rabbit pAb (A0699)}

Western blot - Desmin Rabbit pAb (A0699)

Western blot analysis of lysates from C2C12 cells using Desmin Rabbit pAb(A0699) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:1s.
ABclonal:Immunohistochemistry - Desmin Rabbit pAb (A0699)}

Immunohistochemistry - Desmin Rabbit pAb (A0699)

Immunohistochemistry analysis of Desmin in paraffin-embedded human colon using Desminmin Rabbit pAb (A0699) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Desmin Rabbit pAb (A0699)}

Immunohistochemistry - Desmin Rabbit pAb (A0699)

Immunohistochemistry analysis of Desmin in paraffin-embedded mouse lung using Desminmin Rabbit pAb (A0699) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Desmin Rabbit pAb (A0699)}

Immunofluorescence - Desmin Rabbit pAb (A0699)

Immunofluorescence analysis of paraffin-embedded rat heart using Desminmin Rabbit pAb (A0699) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0699 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DES. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DES. (Distance between topics and target gene indicate popularity.) DES

* Data provided by citexs.com, for reference only.

Publishing research using A0699? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order