Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Desmin Rabbit mAb (A3736)

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Desmin Rabbit mAb (A3736)

Western blot analysis of various lysates using Desmin Rabbit mAb (A3736) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human stomach tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human smooth muscle tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human prostate cancer tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human thyroid tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human lung tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - Desmin Rabbit mAb (A3736)

Immunofluorescence analysis of paraffin-embedded mouse heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Desmin Rabbit mAb (A3736)

Immunofluorescence analysis of paraffin-embedded rat heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Desmin Rabbit mAb
Catalog No. A3736
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0235

Background

This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 371-470 of human Desmin (P17661).
Sequence EEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Gene ID 1674
Swiss prot P17661
Synonyms CSM1; CSM2; CDCD3; LGMD1D; LGMD1E; LGMD2R; Desmin
Calculated MW 54kDa
Observed MW 54kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC MouseRat
WB MouseRat
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples C2C12, RD, Mouse lung, Mouse heart, Rat heart
Cellular location Cell membrane, Cytoplasm, sarcolemma
Customer validation

WB (Mus musculus)

IF (Mus musculus, Homo sapiens)

IHC (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Desmin Rabbit mAb images

ABclonal:Western blot - Desmin Rabbit mAb (A3736)}

Western blot - Desmin Rabbit mAb (A3736)

Western blot analysis of various lysates using Desmin Rabbit mAb (A3736) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)}

Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human stomach tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)}

Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human smooth muscle tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)}

Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human prostate cancer tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)}

Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human thyroid tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunohistochemistry - Desmin Rabbit mAb (A3736)}

Immunohistochemistry - Desmin Rabbit mAb (A3736)

Immunohistochemistry analysis of Desmin in paraffin-embedded human lung tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
ABclonal:Immunofluorescence - Desmin Rabbit mAb (A3736)}

Immunofluorescence - Desmin Rabbit mAb (A3736)

Immunofluorescence analysis of paraffin-embedded mouse heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Desmin Rabbit mAb (A3736)}

Immunofluorescence - Desmin Rabbit mAb (A3736)

Immunofluorescence analysis of paraffin-embedded rat heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A3736 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DES. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DES. (Distance between topics and target gene indicate popularity.) DES

* Data provided by citexs.com, for reference only.

Publishing research using A3736? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order