Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DYNLRB1 Rabbit pAb (A15197)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - DYNLRB1 Rabbit pAb (A15197)

Western blot analysis of extracts of various cell lines, using DYNLRB1 antibody (A15197) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - DYNLRB1 Rabbit pAb (A15197)

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using DYNLRB1 Rabbit pAb (A15197) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name DYNLRB1 Rabbit pAb
Catalog No. A15197
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-63 of human DYNLRB1 (NP_001268656.1).
Sequence MDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Gene ID 83658
Swiss prot Q9NP97
Synonyms BLP; BITH; DNCL2A; DNLC2A; ROBLD1; DYNLRB1
Calculated MW 11kDa
Observed MW 11kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples U-87MG, Mouse brain
Cellular location Cytoplasm, cytoskeleton
Customer validation

WB (Homo sapiens)

ICC (Homo sapiens)

PLA (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DYNLRB1 Rabbit pAb images

ABclonal:Western blot - DYNLRB1 Rabbit pAb (A15197)}

Western blot - DYNLRB1 Rabbit pAb (A15197)

Western blot analysis of extracts of various cell lines, using DYNLRB1 antibody (A15197) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - DYNLRB1 Rabbit pAb (A15197)}

Immunohistochemistry - DYNLRB1 Rabbit pAb (A15197)

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using DYNLRB1 Rabbit pAb (A15197) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A15197 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DYNLRB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DYNLRB1. (Distance between topics and target gene indicate popularity.) DYNLRB1

* Data provided by citexs.com, for reference only.

Publishing research using A15197? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order