Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

DUSP6 Rabbit mAb (A0133)

Reviews (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - DUSP6 Rabbit mAb (A0133)

Western blot analysis of extracts of various cell lines, using DUSP6 Rabbit mAb (A0133) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - DUSP6 Rabbit mAb (A0133)

Immunohistochemistry analysis of paraffin-embedded human colon using DUSP6 Rabbit mAb (A0133) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Review
ABclonal: review for DUSP6 Rabbit mAb(A0133)
Review
ABclonal: review for DUSP6 Rabbit mAb(A0133)
Review
ABclonal: review for DUSP6 Rabbit mAb(A0133)
Review
ABclonal: review for DUSP6 Rabbit mAb(A0133)

You may also interested in:

Overview

Product name DUSP6 Rabbit mAb
Catalog No. A0133
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0237

Background

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK2, is expressed in a variety of tissues with the highest levels in heart and pancreas, and unlike most other members of this family, is localized in the cytoplasm. Mutations in this gene have been associated with congenital hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 282-381 of human DUSP6 (Q16828).
Sequence ARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST
Gene ID 1848
Swiss prot Q16828
Synonyms HH19; MKP3; PYST1; DUSP6
Calculated MW 42kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P Human
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HepG2, Mouse brain, Rat testis
Cellular location Cytoplasm
Customer validation

(HepG2 、PC-3 、COLO205, HepG2、PC-3、COLO205)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DUSP6 Rabbit mAb images

ABclonal:Western blot - DUSP6 Rabbit mAb (A0133)}

Western blot - DUSP6 Rabbit mAb (A0133)

Western blot analysis of extracts of various cell lines, using DUSP6 Rabbit mAb (A0133) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Immunohistochemistry - DUSP6 Rabbit mAb (A0133)}

Immunohistochemistry - DUSP6 Rabbit mAb (A0133)

Immunohistochemistry analysis of paraffin-embedded human colon using DUSP6 Rabbit mAb (A0133) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Submit an review for A0133

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0133 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DUSP6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DUSP6. (Distance between topics and target gene indicate popularity.) DUSP6

* Data provided by citexs.com, for reference only.

Publishing research using A0133? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order