Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DR5/TRAILR2/TNFRSF10B Rabbit pAb (A1236)

Review (1) Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - DR5/TRAILR2/TNFRSF10B Rabbit pAb (A1236)

Western blot analysis of extracts of Jurkat cells, using DR5/TRAILR2/TNFRSF10B antibody (A1236) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Review
ABclonal: review for DR5/TRAILR2/TNFRSF10B Rabbit pAb(A1236)

You may also interested in:

Overview

Product name DR5/TRAILR2/TNFRSF10B Rabbit pAb
Catalog No. A1236
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-440 of human DR5/TRAILR2/TNFRSF10B (NP_003833.4).
Sequence RSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIEDHLLSSGKFMYLEGNADSAMS
Gene ID 8795
Swiss prot O14763
Synonyms DR5; CD262; KILLER; TRICK2; TRICKB; ZTNFR9; TRAILR2; TRICK2A; TRICK2B; TRAIL-R2; KILLER/DR5; DR5/TRAILR2/TNFRSF10B
Calculated MW 48kDa
Observed MW 48kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

WB (Human fibrosarcoma cellsHomo sapiens, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DR5/TRAILR2/TNFRSF10B Rabbit pAb images

ABclonal:Western blot - DR5/TRAILR2/TNFRSF10B Rabbit pAb (A1236)}

Western blot - DR5/TRAILR2/TNFRSF10B Rabbit pAb (A1236)

Western blot analysis of extracts of Jurkat cells, using DR5/TRAILR2/TNFRSF10B antibody (A1236) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Submit an review for A1236

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1236 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNFRSF10B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TNFRSF10B. (Distance between topics and target gene indicate popularity.) TNFRSF10B

* Data provided by citexs.com, for reference only.

Publishing research using A1236? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Proteins (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order