Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

DNPH1 Rabbit mAb (A2382)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - DNPH1 Rabbit mAb (A2382)

Western blot analysis of various lysates using DNPH1 Rabbit mAb (A2382) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - DNPH1 Rabbit mAb (A2382)

Confocal imaging of MCF7 cells using DNPH1 Rabbit mAb (A2382, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

You may also interested in:

Overview

Product name DNPH1 Rabbit mAb
Catalog No. A2382
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2571

Background

This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 75-174 of human DNPH1 (O43598).
Sequence LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT
Gene ID 10591
Swiss prot O43598
Synonyms RCL; C6orf108; dJ330M21.3; DNPH1
Calculated MW 19kDa
Observed MW 20kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
IF/ICC HumanMouse
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, BT-474
Cellular location Cytosol, Extracellular exosome, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

DNPH1 Rabbit mAb images

ABclonal:Western blot - DNPH1 Rabbit mAb (A2382)}

Western blot - DNPH1 Rabbit mAb (A2382)

Western blot analysis of various lysates using DNPH1 Rabbit mAb (A2382) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - DNPH1 Rabbit mAb (A2382)}

Immunofluorescence - DNPH1 Rabbit mAb (A2382)

Confocal imaging of MCF7 cells using DNPH1 Rabbit mAb (A2382, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Inquire About This Product

Submit your question about A2382 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DNPH1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DNPH1. (Distance between topics and target gene indicate popularity.) DNPH1

* Data provided by citexs.com, for reference only.

Publishing research using A2382? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order