Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

GSDME Rabbit pAb (A7432)

Publications (13) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - GSDME Rabbit pAb (A7432)

Western blot analysis of lysates from SH-SY5Y cells using GSDME Rabbit pAb (A7432) at 1:1000 dilution. SH-SY5Y cells were treated by Etopoisde.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
WB samples for antibody validation are kindly provided by Dr. Feng Shao, NIBS

ABclonal:Immunohistochemistry - GSDME Rabbit pAb (A7432)

Immunohistochemistry analysis of GSDME in paraffin-embedded Human pulmonary tuberculosis using GSDME Rabbit pAb (A7432) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - GSDME Rabbit pAb (A7432)

Immunohistochemistry analysis of GSDME in paraffin-embedded Human pancreatic panniculitis using GSDME Rabbit pAb (A7432) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - GSDME Rabbit pAb (A7432)

Immunofluorescence analysis of U2OS cells using GSDME Rabbit pAb (A7432) at dilution of 1:50. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - GSDME Rabbit pAb (A7432)

Immunofluorescence analysis of NIH/3T3 cells using GSDME Rabbit pAb (A7432) at dilution of 1:50. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - GSDME Rabbit pAb (A7432)

Immunofluorescence analysis of PC-12 cells using GSDME Rabbit pAb (A7432) at dilution of 1:50. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name GSDME Rabbit pAb
Catalog No. A7432
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-270 of human GSDME (NP_004394.1).
Sequence MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPKYQFLSLTLGDVLIEDQFPSPVVVESDFVKYEGKFANHVSGTLETALGKVKLNLGGSSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGNVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPD
Gene ID 1687
Swiss prot O60443
Synonyms DFNA5; ICERE-1; GSDME
Calculated MW 55kDa
Observed MW 30kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SH-SY5Y+Etoposide
Cellular location cytoplasm, cytosol, plasma membrane
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus)

IHC (Homo sapiens, Mus musculus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GSDME Rabbit pAb images

ABclonal:Western blot - GSDME Rabbit pAb (A7432)}

Western blot - GSDME Rabbit pAb (A7432)

Western blot analysis of lysates from SH-SY5Y cells using GSDME Rabbit pAb (A7432) at 1:1000 dilution. SH-SY5Y cells were treated by Etopoisde.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
WB samples for antibody validation are kindly provided by Dr. Feng Shao, NIBS
ABclonal:Immunohistochemistry - GSDME Rabbit pAb (A7432)}

Immunohistochemistry - GSDME Rabbit pAb (A7432)

Immunohistochemistry analysis of GSDME in paraffin-embedded Human pulmonary tuberculosis using GSDME Rabbit pAb (A7432) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - GSDME Rabbit pAb (A7432)}

Immunohistochemistry - GSDME Rabbit pAb (A7432)

Immunohistochemistry analysis of GSDME in paraffin-embedded Human pancreatic panniculitis using GSDME Rabbit pAb (A7432) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - GSDME Rabbit pAb (A7432)}

Immunofluorescence - GSDME Rabbit pAb (A7432)

Immunofluorescence analysis of U2OS cells using GSDME Rabbit pAb (A7432) at dilution of 1:50. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - GSDME Rabbit pAb (A7432)}

Immunofluorescence - GSDME Rabbit pAb (A7432)

Immunofluorescence analysis of NIH/3T3 cells using GSDME Rabbit pAb (A7432) at dilution of 1:50. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - GSDME Rabbit pAb (A7432)}

Immunofluorescence - GSDME Rabbit pAb (A7432)

Immunofluorescence analysis of PC-12 cells using GSDME Rabbit pAb (A7432) at dilution of 1:50. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7432 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GSDME. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GSDME. (Distance between topics and target gene indicate popularity.) GSDME

* Data provided by citexs.com, for reference only.

Publishing research using A7432? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order