Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cytokeratin 5 (KRT5) Rabbit pAb (A2662)

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)

Western blot analysis of various lysates using Cytokeratin 5 (KRT5) Rabbit pAb (A2662) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)

Immunohistochemistry analysis of Cytokeratin 5 (KRT5) in paraffin-embedded Human esophageal cancer using Cytokeratin 5 (Cytokeratin 5 (KRT5)) Rabbit pAb (A2662) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)

Immunofluorescence analysis of L929 cells using Cytokeratin 5 (Cytokeratin 5 (KRT5)) Rabbit pAb (A2662) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)

Immunoprecipitation analysis of 200 μg extracts of A-431 cells using 3 μg Cytokeratin 5 (Cytokeratin 5 (KRT5)) antibody (A2662). Western blot was performed from the immunoprecipitate using Cytokeratin 5 (Cytokeratin 5 (KRT5)) antibody (A2662) at a dilution of 1:5000.

You may also interested in:

Overview

Product name Cytokeratin 5 (KRT5) Rabbit pAb
Catalog No. A2662
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the basal layer of the epidermis with family member KRT14. Mutations in these genes have been associated with a complex of diseases termed epidermolysis bullosa simplex. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 5 (KRT5) (NP_000415.2).
Sequence MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGG
Gene ID 3852
Swiss prot P13647
Synonyms K5; CK5; DDD; DDD1; EBS1; EBS2; EBS2A; EBS2B; EBS2C; EBS2D; EBS2E; EBS2F; KRT5A; Cytokeratin 5 (KRT5)
Calculated MW 62kDa
Observed MW 62kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples A375, PC-3
Cellular location cytoplasm, cytosol, extracellular exosome, nucleus
Customer validation

IHC (Mus musculus, Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cytokeratin 5 (KRT5) Rabbit pAb images

ABclonal:Western blot - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)}

Western blot - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)

Western blot analysis of various lysates using Cytokeratin 5 (KRT5) Rabbit pAb (A2662) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)}

Immunohistochemistry - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)

Immunohistochemistry analysis of Cytokeratin 5 (KRT5) in paraffin-embedded Human esophageal cancer using Cytokeratin 5 (Cytokeratin 5 (KRT5)) Rabbit pAb (A2662) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)}

Immunofluorescence - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)

Immunofluorescence analysis of L929 cells using Cytokeratin 5 (Cytokeratin 5 (KRT5)) Rabbit pAb (A2662) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)}

Immunoprecipitation - Cytokeratin 5 (KRT5) Rabbit pAb (A2662)

Immunoprecipitation analysis of 200 μg extracts of A-431 cells using 3 μg Cytokeratin 5 (Cytokeratin 5 (KRT5)) antibody (A2662). Western blot was performed from the immunoprecipitate using Cytokeratin 5 (Cytokeratin 5 (KRT5)) antibody (A2662) at a dilution of 1:5000.

Inquire About This Product

Submit your question about A2662 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KRT5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KRT5. (Distance between topics and target gene indicate popularity.) KRT5

* Data provided by citexs.com, for reference only.

Publishing research using A2662? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order