Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Cystathionase/CTH Rabbit mAb (A5101)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity: Mouse, Rat

ABclonal:Western blot - Cystathionase/CTH Rabbit mAb (A5101)

Western blot analysis of extracts of various cell lines, using Cystathionase/CTH Rabbit mAb (A5101) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

You may also interested in:

Overview

Product name Cystathionase/CTH Rabbit mAb
Catalog No. A5101
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1200

Background

This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cystathionase/CTH (P32929).
Sequence MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHL
Gene ID 1491
Swiss prot P32929
Synonyms CGL; CSE; Cystathionase/CTH
Calculated MW 45kDa
Observed MW 44kDa

Applications

Reactivity Mouse, Rat
Tested applications Testing results
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse liver, Mouse kidney, Rat liver, Rat kidney
Cellular location Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cystathionase/CTH Rabbit mAb images

ABclonal:Western blot - Cystathionase/CTH Rabbit mAb (A5101)}

Western blot - Cystathionase/CTH Rabbit mAb (A5101)

Western blot analysis of extracts of various cell lines, using Cystathionase/CTH Rabbit mAb (A5101) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Inquire About This Product

Submit your question about A5101 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CTH. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CTH. (Distance between topics and target gene indicate popularity.) CTH

* Data provided by citexs.com, for reference only.

Publishing research using A5101? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order