Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Cyclophilin 40 Rabbit mAb (A5097)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cyclophilin 40 Rabbit mAb (A5097)

Western blot analysis of extracts of various cell lines, using Cyclophilin 40 Rabbit mAb (A5097) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Cyclophilin 40 Rabbit mAb (A5097)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Cyclophilin 40 Rabbit mAb (A5097) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Cyclophilin 40 Rabbit mAb
Catalog No. A5097
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1260

Background

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 271-370 of human Cyclophilin 40 (Q08752).
Sequence IALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA
Gene ID 5481
Swiss prot Q08752
Synonyms CYPD; CYP-40; Cyclophilin 40
Calculated MW 41kDa
Observed MW 41kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P Human
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples NIH/3T3, Jurkat, C6, Mouse brain, Rat brain
Cellular location Cytoplasm, Nucleus, nucleolus, nucleoplasm
Customer validation

WB (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Cyclophilin 40 Rabbit mAb images

ABclonal:Western blot - Cyclophilin 40 Rabbit mAb (A5097)}

Western blot - Cyclophilin 40 Rabbit mAb (A5097)

Western blot analysis of extracts of various cell lines, using Cyclophilin 40 Rabbit mAb (A5097) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - Cyclophilin 40 Rabbit mAb (A5097)}

Immunohistochemistry - Cyclophilin 40 Rabbit mAb (A5097)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Cyclophilin 40 Rabbit mAb (A5097) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A5097 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on PPID. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to PPID. (Distance between topics and target gene indicate popularity.) PPID

* Data provided by citexs.com, for reference only.

Publishing research using A5097? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order