Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cyclin H Rabbit pAb (A0995)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - Cyclin H Rabbit pAb (A0995)

Western blot analysis of various lysates using Cyclin H Rabbit pAb (A0995) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - Cyclin H Rabbit pAb (A0995)

Immunoprecipitation analysis of 200 μg extracts of K562 cells using 1 μg Cyclin H antibody (A0995). Western blot was performed from the immunoprecipitate using Cyclin H antibody (A0995) at a dilution of 1:1000.

You may also interested in:

Overview

Product name Cyclin H Rabbit pAb
Catalog No. A0995
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. A pseudogene of this gene is found on chromosome 4. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human Cyclin H (NP_001230.1).
Sequence MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Gene ID 902
Swiss prot P51946
Synonyms CAK; p34; p37; CycH; Cyclin H
Calculated MW 38kDa
Observed MW 36kDa/

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples Jurkat, K-562, SW620, HT-29, MCF7, Jurkat, K-562, SW620
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cyclin H Rabbit pAb images

ABclonal:Western blot - Cyclin H Rabbit pAb (A0995)}

Western blot - Cyclin H Rabbit pAb (A0995)

Western blot analysis of various lysates using Cyclin H Rabbit pAb (A0995) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunoprecipitation - Cyclin H Rabbit pAb (A0995)}

Immunoprecipitation - Cyclin H Rabbit pAb (A0995)

Immunoprecipitation analysis of 200 μg extracts of K562 cells using 1 μg Cyclin H antibody (A0995). Western blot was performed from the immunoprecipitate using Cyclin H antibody (A0995) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A0995 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CCNH. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CCNH. (Distance between topics and target gene indicate popularity.) CCNH

* Data provided by citexs.com, for reference only.

Publishing research using A0995? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order