Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Cyclin H Rabbit mAb (A4076)

Review (1) Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Cyclin H Rabbit mAb (A4076)

Western blot analysis of extracts of various cell lines, using Cyclin H Rabbit mAb (A4076) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - Cyclin H Rabbit mAb (A4076)

Immunohistochemistry analysis of paraffin-embedded mouse testis using Cyclin H Rabbit mAb (A4076) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Cyclin H Rabbit mAb (A4076)

Immunofluorescence analysis of NIH-3T3 cells using Cyclin H Rabbit mAb (A4076) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Cyclin H Rabbit mAb (A4076)

Immunofluorescence analysis of U-2 OS cells using Cyclin H Rabbit mAb (A4076) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for Cyclin H Rabbit mAb(A4076)

You may also interested in:

Overview

Product name Cyclin H Rabbit mAb
Catalog No. A4076
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0893

Background

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. A pseudogene of this gene is found on chromosome 4. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 224-323 of human Cyclin H (P51946).
Sequence AGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Gene ID 902
Swiss prot P51946
Synonyms CAK; p34; p37; CycH; Cyclin H
Calculated MW 38kDa
Observed MW 34kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
IF/ICC HumanMouse
IHC-P Mouse
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, Hep G2, Jurkat, Mouse testis
Cellular location Nucleus
Customer validation

(HT29)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cyclin H Rabbit mAb images

ABclonal:Western blot - Cyclin H Rabbit mAb (A4076)}

Western blot - Cyclin H Rabbit mAb (A4076)

Western blot analysis of extracts of various cell lines, using Cyclin H Rabbit mAb (A4076) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - Cyclin H Rabbit mAb (A4076)}

Immunohistochemistry - Cyclin H Rabbit mAb (A4076)

Immunohistochemistry analysis of paraffin-embedded mouse testis using Cyclin H Rabbit mAb (A4076) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Cyclin H Rabbit mAb (A4076)}

Immunofluorescence - Cyclin H Rabbit mAb (A4076)

Immunofluorescence analysis of NIH-3T3 cells using Cyclin H Rabbit mAb (A4076) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Cyclin H Rabbit mAb (A4076)}

Immunofluorescence - Cyclin H Rabbit mAb (A4076)

Immunofluorescence analysis of U-2 OS cells using Cyclin H Rabbit mAb (A4076) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A4076

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A4076 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CCNH. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CCNH. (Distance between topics and target gene indicate popularity.) CCNH

* Data provided by citexs.com, for reference only.

Publishing research using A4076? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order