Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cyclin B1 Rabbit pAb (A16038)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cyclin B1 Rabbit pAb (A16038)

Western blot analysis of various lysates using Cyclin B1 Rabbit pAb (A16038) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)

Immunohistochemistry analysis of Cyclin B1 in paraffin-embedded rat testis using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)

Immunohistochemistry analysis of Cyclin B1 in paraffin-embedded human lung cancer using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)

Immunohistochemistry analysis of Cyclin B1 in paraffin-embedded human breast cancer using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)

Immunohistochemistry analysis of Cyclin B1 in paraffin-embedded mouse testis using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Cyclin B1 Rabbit pAb (A16038)

Immunofluorescence analysis of HeLa cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Cyclin B1 Rabbit pAb (A16038)

Immunofluorescence analysis of NIH/3T3 cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Cyclin B1 Rabbit pAb (A16038)

Immunofluorescence analysis of PC-12 cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Cyclin B1 Rabbit pAb (A16038)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells, using 3 μg Cyclin B1 antibody (A16038). Western blot was performed from the immunoprecipitate using Cyclin B1 antibody (A16038) at a dilution of 1:1000.

You may also interested in:

Overview

Product name Cyclin B1 Rabbit pAb
Catalog No. A16038
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 334-433 of human Cyclin B1 (NP_114172.1).
Sequence YDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Gene ID 891
Swiss prot P14635
Synonyms CCNB; Cyclin B1
Calculated MW 48kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples C2C12, C6
Cellular location Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center
Customer validation

WB (Mus musculus, Homo sapiens, Rattus norvegicus)

IHC (Danio rerio)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cyclin B1 Rabbit pAb images

ABclonal:Western blot - Cyclin B1 Rabbit pAb (A16038)}

Western blot - Cyclin B1 Rabbit pAb (A16038)

Western blot analysis of various lysates using Cyclin B1 Rabbit pAb (A16038) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)}

Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)

Immunohistochemistry analysis of Cyclin B1 in paraffin-embedded rat testis using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)}

Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)

Immunohistochemistry analysis of Cyclin B1 in paraffin-embedded human lung cancer using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)}

Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)

Immunohistochemistry analysis of Cyclin B1 in paraffin-embedded human breast cancer using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)}

Immunohistochemistry - Cyclin B1 Rabbit pAb (A16038)

Immunohistochemistry analysis of Cyclin B1 in paraffin-embedded mouse testis using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Cyclin B1 Rabbit pAb (A16038)}

Immunofluorescence - Cyclin B1 Rabbit pAb (A16038)

Immunofluorescence analysis of HeLa cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Cyclin B1 Rabbit pAb (A16038)}

Immunofluorescence - Cyclin B1 Rabbit pAb (A16038)

Immunofluorescence analysis of NIH/3T3 cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Cyclin B1 Rabbit pAb (A16038)}

Immunofluorescence - Cyclin B1 Rabbit pAb (A16038)

Immunofluorescence analysis of PC-12 cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - Cyclin B1 Rabbit pAb (A16038)}

Immunoprecipitation - Cyclin B1 Rabbit pAb (A16038)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells, using 3 μg Cyclin B1 antibody (A16038). Western blot was performed from the immunoprecipitate using Cyclin B1 antibody (A16038) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A16038 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CCNB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CCNB1. (Distance between topics and target gene indicate popularity.) CCNB1

* Data provided by citexs.com, for reference only.

Publishing research using A16038? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order