Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Cullin 1 Rabbit pAb (A2136)

Review (1) Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Cullin 1 Rabbit pAb (A2136)

Western blot analysis of extracts of various cell lines, using Cullin 1 antibody (A2136) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded human colon using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded rat lung using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded human colon using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded rat lung using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Cullin 1 Rabbit pAb (A2136)

Immunofluorescence analysis of HeLa cells using Cullin 1 antibody (A2136). Blue: DAPI for nuclear staining.

Review
ABclonal: review for Cullin 1 Rabbit pAb(A2136)

You may also interested in:

Overview

Product name Cullin 1 Rabbit pAb
Catalog No. A2136
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable ubiquitin protein ligase binding activity and ubiquitin-protein transferase activity. Involved in SCF-dependent proteasomal ubiquitin-dependent protein catabolic process and protein ubiquitination. Located in plasma membrane. Part of Parkin-FBXW7-Cul1 ubiquitin ligase complex and SCF ubiquitin ligase complex.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 435-593 of human Cullin 1 (NP_003583.2).
Sequence KNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTN
Gene ID 8454
Swiss prot Q13616
Synonyms Cullin 1; CUL1; cullin-1; MGC149834; MGC149835
Calculated MW 90kDa
Observed MW 80kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:10 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples A-549, MCF7, NIH/3T3, K-562, C6, Mouse liver, Mouse brain, Rat testis
Cellular location cytosol, nucleoplasm, plasma membrane
Customer validation

WB (Human uterine stromal cellsHomo sapiens, Mus musculus, Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Cullin 1 Rabbit pAb images

ABclonal:Western blot - Cullin 1 Rabbit pAb (A2136)}

Western blot - Cullin 1 Rabbit pAb (A2136)

Western blot analysis of extracts of various cell lines, using Cullin 1 antibody (A2136) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)}

Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded human colon using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)}

Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)}

Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded rat lung using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)}

Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded human colon using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)}

Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)}

Immunohistochemistry - Cullin 1 Rabbit pAb (A2136)

Immunohistochemistry analysis of paraffin-embedded rat lung using Cullin 1 Rabbit pAb (A2136) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Cullin 1 Rabbit pAb (A2136)}

Immunofluorescence - Cullin 1 Rabbit pAb (A2136)

Immunofluorescence analysis of HeLa cells using Cullin 1 antibody (A2136). Blue: DAPI for nuclear staining.

Submit an review for A2136

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2136 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CUL1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CUL1. (Distance between topics and target gene indicate popularity.) CUL1

* Data provided by citexs.com, for reference only.

Publishing research using A2136? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order