Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Contactin 2 Rabbit mAb (A5137)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Contactin 2 Rabbit mAb (A5137)

Western blot analysis of extracts of various cell lines, using Contactin 2 Rabbit mAb (A5137) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name Contactin 2 Rabbit mAb
Catalog No. A5137
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1984

Background

This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Contactin 2 (Q02246).
Sequence MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNP
Gene ID 6900
Swiss prot Q02246
Synonyms AXT; TAX; TAX1; FAME5; TAG-1; Contactin 2
Calculated MW 113kDa
Observed MW 150kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, C6, SH-SY5Y, U-251MG, Mouse lung, Mouse spinal cord, Mouse brain, Rat brain
Cellular location Cell membrane, GPI-anchor, Lipid-anchor

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Contactin 2 Rabbit mAb images

ABclonal:Western blot - Contactin 2 Rabbit mAb (A5137)}

Western blot - Contactin 2 Rabbit mAb (A5137)

Western blot analysis of extracts of various cell lines, using Contactin 2 Rabbit mAb (A5137) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A5137 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CNTN2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CNTN2. (Distance between topics and target gene indicate popularity.) CNTN2

* Data provided by citexs.com, for reference only.

Publishing research using A5137? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order