Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Collagen X/COL10A1 Rabbit mAb (A11645)

Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - Collagen X/COL10A1 Rabbit mAb (A11645)

Western blot analysis of various lysates using Collagen X/COL10A1 Rabbit mAb (A11645) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name Collagen X/COL10A1 Rabbit mAb
Catalog No. A11645
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0659

Background

This gene encodes the alpha chain of type X collagen, a short chain collagen expressed by hypertrophic chondrocytes during endochondral ossification. Unlike type VIII collagen, the other short chain collagen, type X collagen is a homotrimer. Mutations in this gene are associated with Schmid type metaphyseal chondrodysplasia (SMCD) and Japanese type spondylometaphyseal dysplasia (SMD).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen X/COL10A1 (Q03692).
Sequence HSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFS
Gene ID 1300
Swiss prot Q03692
Synonyms COL10A1; collagen alpha-1(X) chain; Collagen X/COL10A1
Calculated MW 66kDa
Observed MW 66kDa

Applications

Reactivity Mouse, Rat
Tested applications Testing results
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse liver, Rat liver
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

WB (Gallus gallus, Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Collagen X/COL10A1 Rabbit mAb images

ABclonal:Western blot - Collagen X/COL10A1 Rabbit mAb (A11645)}

Western blot - Collagen X/COL10A1 Rabbit mAb (A11645)

Western blot analysis of various lysates using Collagen X/COL10A1 Rabbit mAb (A11645) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A11645 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on COL10A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to COL10A1. (Distance between topics and target gene indicate popularity.) COL10A1

* Data provided by citexs.com, for reference only.

Publishing research using A11645? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order