Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Collagen VI/COL6A1 Rabbit pAb (A9236)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Collagen VI/COL6A1 Rabbit pAb (A9236)

Western blot analysis of extracts of various cell lines, using Collagen VI/Collagen VI/COL6A1 antibody (A9236) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name Collagen VI/COL6A1 Rabbit pAb
Catalog No. A9236
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils. The basic structural unit of collagen VI is a heterotrimer of the alpha1(VI), alpha2(VI), and alpha3(VI) chains. The alpha2(VI) and alpha3(VI) chains are encoded by the COL6A2 and COL6A3 genes, respectively. The protein encoded by this gene is the alpha 1 subunit of type VI collagen (alpha1(VI) chain). Mutations in the genes that code for the collagen VI subunits result in the autosomal dominant disorder, Bethlem myopathy.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-250 of human Collagen VI/Collagen VI/COL6A1 (NP_001839.2).
Sequence AQDEPETPRAVAFQDCPVDLFFVLDTSESVALRLKPYGALVDKVKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIIQGLTRMPGGRDALKSSVDAVKYFGKGTYTDCAIKKGLEQLLVGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKHLGVKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEAISQTIDTIVDMIKNNVEQVCCSF
Gene ID 1291
Swiss prot P12109
Synonyms OPLL; BTHLM1; UCHMD1; Collagen VI/COL6A1
Calculated MW 109kDa
Observed MW 108kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SKOV3, HepG2, HT-1080, Mouse heart, Mouse lung, Mouse pancreas
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

WB (Mus musculus, Oryctolagus cuniculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Collagen VI/COL6A1 Rabbit pAb images

ABclonal:Western blot - Collagen VI/COL6A1 Rabbit pAb (A9236)}

Western blot - Collagen VI/COL6A1 Rabbit pAb (A9236)

Western blot analysis of extracts of various cell lines, using Collagen VI/Collagen VI/COL6A1 antibody (A9236) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A9236 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on COL6A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to COL6A1. (Distance between topics and target gene indicate popularity.) COL6A1

* Data provided by citexs.com, for reference only.

Publishing research using A9236? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order