Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Collagen I/COL1A2 Rabbit pAb (A16699)

Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Collagen I/COL1A2 Rabbit pAb (A16699)

Western blot analysis of various lysates using Collagen I/COL1A2 Rabbit pAb (A16699) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

You may also interested in:

Overview

Product name Collagen I/COL1A2 Rabbit pAb
Catalog No. A16699
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the pro-alpha2 chain of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIB, recessive Ehlers-Danlos syndrome Classical type, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for the alpha1 chain of type I collagen (COL1A1) reflecting the different role of alpha2 chains in matrix integrity. Three transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1161-1260 of human Collagen I/COL1A2 (NP_000080.2).
Sequence RTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLL
Gene ID 1278
Swiss prot P08123
Synonyms OI4; EDSCV; EDSARTH2; Collagen I/COL1A2
Calculated MW 129kDa
Observed MW 140kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Rat skeletal muscle, Rat skin
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus)

IHC (Mus musculus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Collagen I/COL1A2 Rabbit pAb images

ABclonal:Western blot - Collagen I/COL1A2 Rabbit pAb (A16699)}

Western blot - Collagen I/COL1A2 Rabbit pAb (A16699)

Western blot analysis of various lysates using Collagen I/COL1A2 Rabbit pAb (A16699) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Inquire About This Product

Submit your question about A16699 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on COL1A2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to COL1A2. (Distance between topics and target gene indicate popularity.) COL1A2

* Data provided by citexs.com, for reference only.

Publishing research using A16699? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order