Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] Claudin 1 Rabbit mAb (A21971)

KO/KDValidated

Publications (13) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] Claudin 1 Rabbit mAb (A21971)

Western blot analysis of various lysates using [KO Validated] Claudin 1 Rabbit mAb (A21971) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] Claudin 1 Rabbit mAb (A21971)

Western blot analysis of various lysates using [KO Validated] Claudin 1 Rabbit mAb (A21971) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - [KO Validated] Claudin 1 Rabbit mAb (A21971)

Western blot analysis of lysates from wild type(WT) and Claudin 1 Rabbit mAb knockdown (KD) Hep G2(KO) , using [KO Validated] Claudin 1 Rabbit mAb (A21971) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name [KO Validated] Claudin 1 Rabbit mAb
Catalog No. A21971
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC54475

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Loss of function mutations result in neonatal ichthyosis-sclerosing cholangitis syndrome.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 112-211 of human Claudin 1 (NP_066924.1).
Sequence EVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
Gene ID 9076
Swiss prot O95832
Synonyms CLD1; SEMP1; ILVASC; 1
Calculated MW 23kDa
Observed MW 20kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
IF/ICC Human
Recommended dilution
  • WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-431, Hep G2, Mouse liver, Mouse kidney, Rat kidney
Cellular location Cell junction, Cell membrane, Multi-pass membrane protein, tight junction
Customer validation

WB (Sus scrofa, Mus musculus, Anatinae, Coturnix japonica, Homo sapiens)

IHC (Mus musculus)

IF (Sus scrofa, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] Claudin 1 Rabbit mAb images

ABclonal:Western blot - [KO Validated] Claudin 1 Rabbit mAb (A21971)}

Western blot - [KO Validated] Claudin 1 Rabbit mAb (A21971)

Western blot analysis of various lysates using [KO Validated] Claudin 1 Rabbit mAb (A21971) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] Claudin 1 Rabbit mAb (A21971)}

Western blot - [KO Validated] Claudin 1 Rabbit mAb (A21971)

Western blot analysis of various lysates using [KO Validated] Claudin 1 Rabbit mAb (A21971) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - [KO Validated] Claudin 1 Rabbit mAb (A21971)}

Western blot - [KO Validated] Claudin 1 Rabbit mAb (A21971)

Western blot analysis of lysates from wild type(WT) and Claudin 1 Rabbit mAb knockdown (KD) Hep G2(KO) , using [KO Validated] Claudin 1 Rabbit mAb (A21971) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A21971 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CLDN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CLDN1. (Distance between topics and target gene indicate popularity.) CLDN1

* Data provided by citexs.com, for reference only.

Publishing research using A21971? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order