Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Chk2 Rabbit mAb (A19543)

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Chk2 Rabbit mAb (A19543)

Western blot analysis of lysates from HeLa cells, using Chk2 Rabbit mAb (A19543) at 1:7000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - Chk2 Rabbit mAb (A19543)

Western blot analysis of lysates from C2C12 cells, using Chk2 Rabbit mAb (A19543) at 1:7000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Chk2 Rabbit mAb (A19543)

Immunohistochemistry analysis of Chk2 in paraffin-embedded human colon using Chk2 Rabbit mAb (A19543) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Chk2 Rabbit mAb (A19543)

Immunohistochemistry analysis of Chk2 in paraffin-embedded human testis using Chk2 Rabbit mAb (A19543) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Chk2 Rabbit mAb
Catalog No. A19543
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC57076

Background

In response to DNA damage and replication blocks, cell cycle progression is halted through the control of critical cell cycle regulators. The protein encoded by this gene is a cell cycle checkpoint regulator and putative tumor suppressor. It contains a forkhead-associated protein interaction domain essential for activation in response to DNA damage and is rapidly phosphorylated in response to replication blocks and DNA damage. When activated, the encoded protein is known to inhibit CDC25C phosphatase, preventing entry into mitosis, and has been shown to stabilize the tumor suppressor protein p53, leading to cell cycle arrest in G1. In addition, this protein interacts with and phosphorylates BRCA1, allowing BRCA1 to restore survival after DNA damage. Mutations in this gene have been linked with Li-Fraumeni syndrome, a highly penetrant familial cancer phenotype usually associated with inherited mutations in TP53. Also, mutations in this gene are thought to confer a predisposition to sarcomas, breast cancer, and brain tumors. This nuclear protein is a member of the CDS1 subfamily of serine/threonine protein kinases. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Chk2 (O96017).
Sequence MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQ
Gene ID 11200
Swiss prot O96017
Synonyms CDS1; CHK2; LFS2; RAD53; hCds1; HuCds1; PP1425; Chk2
Calculated MW 15-38kDa/50-65kDa
Observed MW 65kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
IHC-P Human
WB HumanMouse
Recommended dilution
  • WB 1:2000 - 1:8000
  • IHC-P 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, C2C12
Cellular location Nucleus, PML body, nucleoplasm
Customer validation

WB (Homo sapiens)

IHC (Homo sapiens)

RNA pull-down (Homo sapiens)

RIP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Chk2 Rabbit mAb images

ABclonal:Western blot - Chk2 Rabbit mAb (A19543)}

Western blot - Chk2 Rabbit mAb (A19543)

Western blot analysis of lysates from HeLa cells, using Chk2 Rabbit mAb (A19543) at 1:7000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - Chk2 Rabbit mAb (A19543)}

Western blot - Chk2 Rabbit mAb (A19543)

Western blot analysis of lysates from C2C12 cells, using Chk2 Rabbit mAb (A19543) at 1:7000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - Chk2 Rabbit mAb (A19543)}

Immunohistochemistry - Chk2 Rabbit mAb (A19543)

Immunohistochemistry analysis of Chk2 in paraffin-embedded human colon using Chk2 Rabbit mAb (A19543) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Chk2 Rabbit mAb (A19543)}

Immunohistochemistry - Chk2 Rabbit mAb (A19543)

Immunohistochemistry analysis of Chk2 in paraffin-embedded human testis using Chk2 Rabbit mAb (A19543) at dilution of 1:300 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19543 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CHEK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CHEK2. (Distance between topics and target gene indicate popularity.) CHEK2

* Data provided by citexs.com, for reference only.

Publishing research using A19543? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order