Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Caspase-8 Rabbit pAb (A0215)

Reviews (2) Publications (44) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Caspase-8 Rabbit pAb (A0215)

Western blot analysis of various lysates using Caspase-8 Rabbit pAb (A0215) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Caspase-8 Rabbit pAb (A0215)

Immunohistochemistry analysis of Caspase-8 in paraffin-embedded human colon using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Caspase-8 Rabbit pAb (A0215)

Immunohistochemistry analysis of Caspase-8 in paraffin-embedded mouse kidney using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Caspase-8 Rabbit pAb (A0215)

Immunohistochemistry analysis of Caspase-8 in paraffin-embedded rat lung using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Caspase-8 Rabbit pAb (A0215)

Immunofluorescence analysis of HeLa cells using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Caspase-8 Rabbit pAb (A0215)

Immunofluorescence analysis of HepG2 cells using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Caspase-8 Rabbit pAb (A0215)

Immunofluorescence analysis of NIH/3T3 cells using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Caspase-8 Rabbit pAb (A0215)

Immunofluorescence analysis of PC-12 cells using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Caspase-8 Rabbit pAb(A0215)
Review
ABclonal: review for Caspase-8 Rabbit pAb(A0215)

You may also interested in:

Overview

Product name Caspase-8 Rabbit pAb
Catalog No. A0215
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large protease subunit, and a small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This protein is involved in the programmed cell death induced by Fas and various apoptotic stimuli. The N-terminal FADD-like death effector domain of this protein suggests that it may interact with Fas-interacting protein FADD. This protein was detected in the insoluble fraction of the affected brain region from Huntington disease patients but not in those from normal controls, which implicated the role in neurodegenerative diseases. Many alternatively spliced transcript variants encoding different isoforms have been described, although not all variants have had their full-length sequences determined.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 376-479 of human Caspase 8 (NP_203519.1).
Sequence EEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Gene ID 841
Swiss prot Q14790
Synonyms CAP4; MACH; MCH5; FLICE; ALPS2B; Casp-8; Caspase-8
Calculated MW 55kDa
Observed MW 57kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples C2C12, Jurkat
Cellular location Cytoplasm
Customer validation

WB (Eoma cell, N9Mus musculus, Bos taurus, Homo sapiens, Mus musculus, Rattus norvegicus, Ctenopharyngodon idellus, Sus scrofa, Gallus gallus)

IHC (Rattus norvegicus)

RT-PCR (Ctenopharyngodon idellus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Caspase-8 Rabbit pAb images

ABclonal:Western blot - Caspase-8 Rabbit pAb (A0215)}

Western blot - Caspase-8 Rabbit pAb (A0215)

Western blot analysis of various lysates using Caspase-8 Rabbit pAb (A0215) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - Caspase-8 Rabbit pAb (A0215)}

Immunohistochemistry - Caspase-8 Rabbit pAb (A0215)

Immunohistochemistry analysis of Caspase-8 in paraffin-embedded human colon using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Caspase-8 Rabbit pAb (A0215)}

Immunohistochemistry - Caspase-8 Rabbit pAb (A0215)

Immunohistochemistry analysis of Caspase-8 in paraffin-embedded mouse kidney using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Caspase-8 Rabbit pAb (A0215)}

Immunohistochemistry - Caspase-8 Rabbit pAb (A0215)

Immunohistochemistry analysis of Caspase-8 in paraffin-embedded rat lung using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Caspase-8 Rabbit pAb (A0215)}

Immunofluorescence - Caspase-8 Rabbit pAb (A0215)

Immunofluorescence analysis of HeLa cells using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Caspase-8 Rabbit pAb (A0215)}

Immunofluorescence - Caspase-8 Rabbit pAb (A0215)

Immunofluorescence analysis of HepG2 cells using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Caspase-8 Rabbit pAb (A0215)}

Immunofluorescence - Caspase-8 Rabbit pAb (A0215)

Immunofluorescence analysis of NIH/3T3 cells using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Caspase-8 Rabbit pAb (A0215)}

Immunofluorescence - Caspase-8 Rabbit pAb (A0215)

Immunofluorescence analysis of PC-12 cells using Caspase-8 Rabbit pAb (A0215) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A0215

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0215 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CASP8. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CASP8. (Distance between topics and target gene indicate popularity.) CASP8

* Data provided by citexs.com, for reference only.

Publishing research using A0215? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order