Reviews (2)Publications (29) Datasheet
Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | Caspase-8 Rabbit pAb |
---|---|
Catalog No. | A0215 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 376-479 of human Caspase-8 (NP_203519.1). |
---|---|
Sequence | EEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD |
Gene ID | 841 |
Swiss prot | Q14790 |
Synonyms | ALPS2B; CAP4; Casp-8; FLICE; MACH; MCH5; Caspase 8; CASP8; Caspase-8; caspase-8 |
Calculated MW | 25-32kDa/45- 61kDa |
Observed MW | 57KDa/18KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | C2C12, Jurkat |
Cellular location | Cytoplasm |
Customer validation | (Eoma cell, N9) WB(Mus musculus, Bos taurus, Homo sapiens, Rattus norvegicus, Ctenopharyngodon idellus, Sus scrofa) IHC(Rattus norvegicus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A0215 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A0215? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.