Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Caspase-4 Rabbit pAb (A19305)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - Caspase-4 Rabbit pAb (A19305)

Western blot analysis of extracts of SW620 cells, using Caspase-4 antibody (A19305) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

ABclonal:Western blot - Caspase-4 Rabbit pAb (A19305)

Western blot analysis of extracts of THP-1 cells, using Caspase-4 antibody (A19305) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Caspase-4 Rabbit pAb (A19305)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Caspase-4 Rabbit pAb (A19305) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Caspase-4 Rabbit pAb (A19305)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using Caspase-4 Rabbit pAb (A19305) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name Caspase-4 Rabbit pAb
Catalog No. A19305
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain and a large and small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This caspase is able to cleave and activate its own precursor protein, as well as caspase 1 precursor. When overexpressed, this gene induces cell apoptosis. Alternative splicing results in transcript variants encoding distinct isoforms.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 81-270 of human Caspase-4 (NP_001216.1).
Sequence QISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRD
Gene ID 837
Swiss prot P49662
Synonyms TX; Mih1; ICH-2; Mih1/TX; ICEREL-II; ICE(rel)II; Caspase-4
Calculated MW 43kDa
Observed MW 43kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples SW620, THP-1
Cellular location AIM2 inflammasome complex, cytoplasm, cytosol, endoplasmic reticulum, extracellular region, IPAF inflammasome complex, mitochondrion, NLRP3 inflammasome complex, plasma membrane
Customer validation

WB (Mus musculus, Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Caspase-4 Rabbit pAb images

ABclonal:Western blot - Caspase-4 Rabbit pAb (A19305)}

Western blot - Caspase-4 Rabbit pAb (A19305)

Western blot analysis of extracts of SW620 cells, using Caspase-4 antibody (A19305) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.
ABclonal:Western blot - Caspase-4 Rabbit pAb (A19305)}

Western blot - Caspase-4 Rabbit pAb (A19305)

Western blot analysis of extracts of THP-1 cells, using Caspase-4 antibody (A19305) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - Caspase-4 Rabbit pAb (A19305)}

Immunohistochemistry - Caspase-4 Rabbit pAb (A19305)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Caspase-4 Rabbit pAb (A19305) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Caspase-4 Rabbit pAb (A19305)}

Immunohistochemistry - Caspase-4 Rabbit pAb (A19305)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using Caspase-4 Rabbit pAb (A19305) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A19305 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CASP4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CASP4. (Distance between topics and target gene indicate popularity.) CASP4

* Data provided by citexs.com, for reference only.

Publishing research using A19305? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order