Reviews (3)Publications (18) Datasheet
Product name | Caspase-3 Rabbit pAb |
---|---|
Catalog No. | A0214 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Caspase-3 (NP_004337.2). |
---|---|
Sequence | MRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA |
Gene ID | 836 |
Swiss prot | P42574 |
Synonyms | CPP32; CPP32B; SCA-1; Active Caspase 3; CASP3; active Caspase-3; Caspase 3; Caspase-3 p12; caspase-3 |
Calculated MW | 31kDa |
Observed MW | 15kDa/35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Jurkat, HeLa, 293T, NIH/3T3, mouse lung, mouse liver |
Cellular location | Cytoplasm |
Customer validation | (Eoma cell, U2OS,Saos-2) WB(Mus musculus, Homo sapiens, Rattus norvegicus) IHC(Mus musculus) IF(Mus musculus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at [email protected]
Submit your question about A0214 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A0214? Please let us know so that we can cite the reference in this datasheet.