Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Caspase-3 Mouse mAb (A17900)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - Caspase-3 Mouse mAb (A17900)

Western blot analysis of various lysates using Caspase-3 Mouse mAb (A17900) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name Caspase-3 Mouse mAb
Catalog No. A17900
Host species Mouse
Purification method Affinity purification
Isotype IgG1, Kappa
CloneNo. AMC0214

Background

The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (P42574).
Sequence FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII
Gene ID 836
Swiss prot P42574
Synonyms CPP32; SCA-1; CPP32B; Caspase-3
Calculated MW 32kDa
Observed MW 32kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, HeLa, 293T, Mouse lung, Mouse liver
Cellular location Cytoplasm
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Caspase-3 Mouse mAb images

ABclonal:Western blot - Caspase-3 Mouse mAb (A17900)}

Western blot - Caspase-3 Mouse mAb (A17900)

Western blot analysis of various lysates using Caspase-3 Mouse mAb (A17900) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A17900 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CASP3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CASP3. (Distance between topics and target gene indicate popularity.) CASP3

* Data provided by citexs.com, for reference only.

Publishing research using A17900? Please let us know so that we can cite the reference in this datasheet.

Antibodies (11)

ELISA Kits (1)

Secondary Antibodies (17)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order