Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Caspase-1 Rabbit pAb (A0964)

Reviews (3) Publications (207) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Caspase-1 Rabbit pAb (A0964)

Western blot analysis of various lysates, using CASP1 Rabbit pAb (A0964) at 1:1800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Western blot - Caspase-1 Rabbit pAb (A0964)

Western blot analysis of various lysates, using CASP1 Rabbit pAb (A0964) at 1:1800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - Caspase-1 Rabbit pAb (A0964)

Confocal immunofluorescence analysis of Raw264.7 cells using Caspase-1 Rabbit pAb (A0964) at dilution of 1:200. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Caspase-1 Rabbit pAb (A0964)

Immunofluorescence analysis of PC-12 cells using CASP1 Rabbit pAb (A0964) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Caspase-1 Rabbit pAb (A0964)

Immunofluorescence analysis of NIH/3T3 cells using Caspase-1 Rabbit pAb (A0964) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Caspase-1 Rabbit pAb (A0964)

Immunofluorescence analysis of U2OS cells using Caspase-1 Rabbit pAb (A0964) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for Caspase-1 Rabbit pAb(A0964)
Review
ABclonal: review for Caspase-1 Rabbit pAb(A0964)
Review
ABclonal: review for Caspase-1 Rabbit pAb(A0964)

You may also interested in:

Overview

Product name Caspase-1 Rabbit pAb
Catalog No. A0964
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 201-300 of human Caspase 1 (NP_150634.1).
Sequence DVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
Gene ID 834
Swiss prot P29466
Synonyms ICE; P45; IL1BC; Caspase-1
Calculated MW 45kDa
Observed MW 45kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HepG2, Hela, Mouse lung, Mouse spleen
Cellular location Cytoplasm
Customer validation

IF (Human colon cancer cellMus musculus, Mus musculus, Homo sapiens, Rattus norvegicus)

WB (Human chronic myeloid leukemia cells, N9Mus musculus, Mus musculus, Homo sapiens, Rattus norvegicus, Sus scrofa, Danio rerio, Gallus gallus, Cyprinus carpio, Ctenopharyngodon idella)

IHC (Mus musculus, Rattus norvegicus, Homo sapiens)

ELISA (Mus musculus, Homo sapiens)

IHC WB (Mus musculus)

IHC;WB (Mus musculus)

RT-qPCR (Homo sapiens)

qPCR (Mus musculus)

IP (Mus musculus)

FC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Caspase-1 Rabbit pAb images

ABclonal:Western blot - Caspase-1 Rabbit pAb (A0964)}

Western blot - Caspase-1 Rabbit pAb (A0964)

Western blot analysis of various lysates, using CASP1 Rabbit pAb (A0964) at 1:1800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
ABclonal:Western blot - Caspase-1 Rabbit pAb (A0964)}

Western blot - Caspase-1 Rabbit pAb (A0964)

Western blot analysis of various lysates, using CASP1 Rabbit pAb (A0964) at 1:1800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunofluorescence - Caspase-1 Rabbit pAb (A0964)}

Immunofluorescence - Caspase-1 Rabbit pAb (A0964)

Confocal immunofluorescence analysis of Raw264.7 cells using Caspase-1 Rabbit pAb (A0964) at dilution of 1:200. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Caspase-1 Rabbit pAb (A0964)}

Immunofluorescence - Caspase-1 Rabbit pAb (A0964)

Immunofluorescence analysis of PC-12 cells using CASP1 Rabbit pAb (A0964) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Caspase-1 Rabbit pAb (A0964)}

Immunofluorescence - Caspase-1 Rabbit pAb (A0964)

Immunofluorescence analysis of NIH/3T3 cells using Caspase-1 Rabbit pAb (A0964) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Caspase-1 Rabbit pAb (A0964)}

Immunofluorescence - Caspase-1 Rabbit pAb (A0964)

Immunofluorescence analysis of U2OS cells using Caspase-1 Rabbit pAb (A0964) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A0964

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0964 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CASP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CASP1. (Distance between topics and target gene indicate popularity.) CASP1

* Data provided by citexs.com, for reference only.

Publishing research using A0964? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order