Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CaMKI Rabbit mAb (A3529)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CaMKI Rabbit mAb (A3529)

Western blot analysis of extracts of various cell lines, using CaMKI Rabbit mAb (A3529) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

You may also interested in:

Overview

Product name CaMKI Rabbit mAb
Catalog No. A3529
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2030

Background

Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CaMKI (NP_003647.1).
Sequence MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSG
Gene ID 8536
Swiss prot Q14012
Synonyms CAMKI; CaMKI
Calculated MW 41kDa
Observed MW 41kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Hep G2, Mouse lung, Mouse liver, Rat lung
Cellular location Cytoplasm, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CaMKI Rabbit mAb images

ABclonal:Western blot - CaMKI Rabbit mAb (A3529)}

Western blot - CaMKI Rabbit mAb (A3529)

Western blot analysis of extracts of various cell lines, using CaMKI Rabbit mAb (A3529) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

Inquire About This Product

Submit your question about A3529 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CAMK1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CAMK1. (Distance between topics and target gene indicate popularity.) CAMK1

* Data provided by citexs.com, for reference only.

Publishing research using A3529? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order