Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CYP7A1 Rabbit pAb (A10615)

Publications (16) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CYP7A1 Rabbit pAb (A10615)

Western blot analysis of extracts of various cell lines, using CYP7A1 antibody (A10615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - CYP7A1 Rabbit pAb (A10615)

Immunofluorescence analysis of HepG2 cells using CYP7A1 Rabbit pAb (A10615) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CYP7A1 Rabbit pAb
Catalog No. A10615
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway in the liver, which converts cholesterol to bile acids. This reaction is the rate limiting step and the major site of regulation of bile acid synthesis, which is the primary mechanism for the removal of cholesterol from the body. Polymorphisms in the promoter of this gene are associated with defects in bile acid synthesis.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 390-504 of human CYP7A1 (NP_000771.2).
Sequence YPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILPPLNDIEFKYKFKHL
Gene ID 1581
Swiss prot P22680
Synonyms CP7A; CYP7; CYPVII; CYP7A1
Calculated MW 58kDa
Observed MW 58kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse liver, Rat liver
Cellular location Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein
Customer validation

WB (Mus musculus, Rattus norvegicus, Actinopterygii, Homo sapiens)

IHC (Bubalus bubalis)

IF (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CYP7A1 Rabbit pAb images

ABclonal:Western blot - CYP7A1 Rabbit pAb (A10615)}

Western blot - CYP7A1 Rabbit pAb (A10615)

Western blot analysis of extracts of various cell lines, using CYP7A1 antibody (A10615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - CYP7A1 Rabbit pAb (A10615)}

Immunofluorescence - CYP7A1 Rabbit pAb (A10615)

Immunofluorescence analysis of HepG2 cells using CYP7A1 Rabbit pAb (A10615) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A10615 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CYP7A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CYP7A1. (Distance between topics and target gene indicate popularity.) CYP7A1

* Data provided by citexs.com, for reference only.

Publishing research using A10615? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order