Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CXCR3 Rabbit pAb (A2939)

Publications (5) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CXCR3 Rabbit pAb (A2939)

Western blot analysis of various lysates using CXCR3 Rabbit pAb (A2939) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - CXCR3 Rabbit pAb (A2939)

Western blot analysis of various lysates using CXCR3 Rabbit pAb (A2939) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CXCR3 Rabbit pAb (A2939)

Immunohistochemistry analysis of CXCR3 in paraffin-embedded human liver cancer using CXCR3 Rabbit pAb (A2939) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CXCR3 Rabbit pAb (A2939)

Immunohistochemistry analysis of CXCR3 in paraffin-embedded mouse skeletal muscle using CXCR3 Rabbit pAb (A2939) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CXCR3 Rabbit pAb (A2939)

Immunohistochemistry analysis of CXCR3 in paraffin-embedded mouse heart using CXCR3 Rabbit pAb (A2939) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CXCR3 Rabbit pAb
Catalog No. A2939
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 289-368 of human CXCR3 (NP_001495.1).
Sequence NCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSETSEASYSGL
Gene ID 2833
Swiss prot P49682
Synonyms GPR9; MigR; CD182; CD183; Mig-R; CKR-L2; CMKAR3; IP10-R; CXCR3
Calculated MW 41kDa
Observed MW 44kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293T, K-562, HepG2, SGC996, SW620
Cellular location Cell membrane, Multi-pass membrane protein
Customer validation

IHC (Mus musculus, Homo sapiens)

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CXCR3 Rabbit pAb images

ABclonal:Western blot - CXCR3 Rabbit pAb (A2939)}

Western blot - CXCR3 Rabbit pAb (A2939)

Western blot analysis of various lysates using CXCR3 Rabbit pAb (A2939) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - CXCR3 Rabbit pAb (A2939)}

Western blot - CXCR3 Rabbit pAb (A2939)

Western blot analysis of various lysates using CXCR3 Rabbit pAb (A2939) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - CXCR3 Rabbit pAb (A2939)}

Immunohistochemistry - CXCR3 Rabbit pAb (A2939)

Immunohistochemistry analysis of CXCR3 in paraffin-embedded human liver cancer using CXCR3 Rabbit pAb (A2939) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CXCR3 Rabbit pAb (A2939)}

Immunohistochemistry - CXCR3 Rabbit pAb (A2939)

Immunohistochemistry analysis of CXCR3 in paraffin-embedded mouse skeletal muscle using CXCR3 Rabbit pAb (A2939) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CXCR3 Rabbit pAb (A2939)}

Immunohistochemistry - CXCR3 Rabbit pAb (A2939)

Immunohistochemistry analysis of CXCR3 in paraffin-embedded mouse heart using CXCR3 Rabbit pAb (A2939) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A2939 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CXCR3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CXCR3. (Distance between topics and target gene indicate popularity.) CXCR3

* Data provided by citexs.com, for reference only.

Publishing research using A2939? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order