Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CSTA Rabbit pAb (A5686)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - CSTA Rabbit pAb (A5686)

Western blot analysis of extracts of THP-1 cells, using CSTA antibody (A5686) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - CSTA Rabbit pAb (A5686)

Immunofluorescence analysis of HeLa cells using CSTA antibody (A5686). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CSTA Rabbit pAb
Catalog No. A5686
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human CSTA (NP_005204.1).
Sequence MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Gene ID 1475
Swiss prot P01040
Synonyms AREI; PSS4; STF1; STFA; CSTA
Calculated MW 11kDa
Observed MW 13kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples THP-1
Cellular location Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CSTA Rabbit pAb images

ABclonal:Western blot - CSTA Rabbit pAb (A5686)}

Western blot - CSTA Rabbit pAb (A5686)

Western blot analysis of extracts of THP-1 cells, using CSTA antibody (A5686) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - CSTA Rabbit pAb (A5686)}

Immunofluorescence - CSTA Rabbit pAb (A5686)

Immunofluorescence analysis of HeLa cells using CSTA antibody (A5686). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5686 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CSTA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CSTA. (Distance between topics and target gene indicate popularity.) CSTA

* Data provided by citexs.com, for reference only.

Publishing research using A5686? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Proteins (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order