Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

CPT1A Rabbit mAb (A20746)

Publications (10) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - CPT1A Rabbit mAb (A20746)

Western blot analysis of lysates from MCF7 cells, using CPT1A Rabbit mAb (A20746) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

You may also interested in:

Overview

Product name CPT1A Rabbit mAb
Catalog No. A20746
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC51171

Background

The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 520-720 of human CPT1A (NP_001867.2).
Sequence WDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
Gene ID 1374
Swiss prot P50416
Synonyms CPT1; CPT1-L; L-CPT1; CPT1A
Calculated MW 88kDa
Observed MW 88kDa

Applications

Reactivity Human
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples MCF7
Cellular location mitochondrial outer membrane, mitochondrion
Customer validation

WB (Mus musculus, Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CPT1A Rabbit mAb images

ABclonal:Western blot - CPT1A Rabbit mAb (A20746)}

Western blot - CPT1A Rabbit mAb (A20746)

Western blot analysis of lysates from MCF7 cells, using CPT1A Rabbit mAb (A20746) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Inquire About This Product

Submit your question about A20746 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CPT1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CPT1A. (Distance between topics and target gene indicate popularity.) CPT1A

* Data provided by citexs.com, for reference only.

Publishing research using A20746? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order