Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CPQ Rabbit pAb (A12062)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CPQ Rabbit pAb (A12062)

Western blot analysis of various lysates using CPQ Rabbit pAb (A12062) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

You may also interested in:

Overview

Product name CPQ Rabbit pAb
Catalog No. A12062
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CPQ (NP_057218.1).
Sequence MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGL
Gene ID 10404
Swiss prot Q9Y646
Synonyms LDP; PGCP; CPQ
Calculated MW 52kDa
Observed MW 57-60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, LO2, Mouse kidney, Rat kidney
Cellular location Endoplasmic reticulum, Golgi apparatus, Lysosome, Secreted

Research Area

CPQ Rabbit pAb images

ABclonal:Western blot - CPQ Rabbit pAb (A12062)}

Western blot - CPQ Rabbit pAb (A12062)

Western blot analysis of various lysates using CPQ Rabbit pAb (A12062) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Inquire About This Product

Submit your question about A12062 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CPQ. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CPQ. (Distance between topics and target gene indicate popularity.) CPQ

* Data provided by citexs.com, for reference only.

Publishing research using A12062? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order