Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

COTL1 Rabbit pAb (A4550)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - COTL1 Rabbit pAb (A4550)

Western blot analysis of extracts of various cell lines, using COTL1 antibody (A4550) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - COTL1 Rabbit pAb (A4550)

Immunohistochemistry analysis of paraffin-embedded rat lung using COTL1 Rabbit pAb (A4550) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - COTL1 Rabbit pAb (A4550)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using COTL1 Rabbit pAb (A4550) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - COTL1 Rabbit pAb (A4550)

Immunohistochemistry analysis of paraffin-embedded mouse lung using COTL1 Rabbit pAb (A4550) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name COTL1 Rabbit pAb
Catalog No. A4550
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human COTL1 (NP_066972.1).
Sequence MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
Gene ID 23406
Swiss prot Q14019
Synonyms CLP; COTL1
Calculated MW 16kDa
Observed MW 14kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Jurkat, 293T, U-251MG, HeLa, Mouse lung, Mouse kidney, Mouse spleen
Cellular location Cytoplasm, Nucleus membrane, Peripheral membrane protein, cytoskeleton
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

COTL1 Rabbit pAb images

ABclonal:Western blot - COTL1 Rabbit pAb (A4550)}

Western blot - COTL1 Rabbit pAb (A4550)

Western blot analysis of extracts of various cell lines, using COTL1 antibody (A4550) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - COTL1 Rabbit pAb (A4550)}

Immunohistochemistry - COTL1 Rabbit pAb (A4550)

Immunohistochemistry analysis of paraffin-embedded rat lung using COTL1 Rabbit pAb (A4550) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - COTL1 Rabbit pAb (A4550)}

Immunohistochemistry - COTL1 Rabbit pAb (A4550)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using COTL1 Rabbit pAb (A4550) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - COTL1 Rabbit pAb (A4550)}

Immunohistochemistry - COTL1 Rabbit pAb (A4550)

Immunohistochemistry analysis of paraffin-embedded mouse lung using COTL1 Rabbit pAb (A4550) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A4550 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on COTL1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to COTL1. (Distance between topics and target gene indicate popularity.) COTL1

* Data provided by citexs.com, for reference only.

Publishing research using A4550? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order