Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

COPA Rabbit mAb (A19651)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - COPA Rabbit mAb (A19651)

Western blot analysis of various lysates using COPA Rabbit mAb (A19651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - COPA Rabbit mAb (A19651)

Western blot analysis of lysates from Rat brain, using COPA Rabbit mAb (A19651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded rat colon tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded mouse testis tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded human thyroid cancer tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded human colon tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded human colon carcinoma tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded mouse brain tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

You may also interested in:

Overview

Product name COPA Rabbit mAb
Catalog No. A19651
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2215

Background

In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone. Alternative splicing results in multiple splice forms encoding distinct isoforms.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human COPA (P53621).
Sequence MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTF
Gene ID 1314
Swiss prot P53621
Synonyms AILJK; HEP-COP; alpha-COP; COPA
Calculated MW 138kDa
Observed MW

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanMouseRat
WB MouseRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLA, HT-29, MCF7, Mouse lung, Rat brain
Cellular location COPI vesicle coat, cytoplasm, cytosol, extracellular exosome, extracellular space, transport vesicle

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

COPA Rabbit mAb images

ABclonal:Western blot - COPA Rabbit mAb (A19651)}

Western blot - COPA Rabbit mAb (A19651)

Western blot analysis of various lysates using COPA Rabbit mAb (A19651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - COPA Rabbit mAb (A19651)}

Western blot - COPA Rabbit mAb (A19651)

Western blot analysis of lysates from Rat brain, using COPA Rabbit mAb (A19651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)}

Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded rat colon tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)}

Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded mouse testis tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)}

Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded human thyroid cancer tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)}

Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded human colon tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)}

Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded human colon carcinoma tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - COPA Rabbit mAb (A19651)}

Immunohistochemistry - COPA Rabbit mAb (A19651)

Immunohistochemistry analysis of COPA in paraffin-embedded mouse brain tissue using COPA Rabbit mAb (A19651) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Inquire About This Product

Submit your question about A19651 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on COPA. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to COPA. (Distance between topics and target gene indicate popularity.) COPA

* Data provided by citexs.com, for reference only.

Publishing research using A19651? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order