Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CNR1 Rabbit pAb (A1447)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CNR1 Rabbit pAb (A1447)

Western blot analysis of extracts of various cell lines, using CNR1 antibody (A1447) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - CNR1 Rabbit pAb (A1447)

Immunohistochemistry analysis of paraffin-embedded Human gastric cancer using CNR1 antibody (A1447) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CNR1 Rabbit pAb (A1447)

Immunohistochemistry analysis of paraffin-embedded Human stomach using CNR1 antibody (A1447) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CNR1 Rabbit pAb
Catalog No. A1447
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 401-472 of human CNR1 (NP_001153698.1).
Sequence SKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Gene ID 1268
Swiss prot P21554
Synonyms CB1; CNR; CB-R; CB1A; CB1R; CANN6; CB1K5; CNR1
Calculated MW 53kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse liver, Mouse brain, Rat testis
Cellular location Cell membrane, Multi-pass membrane protein
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CNR1 Rabbit pAb images

ABclonal:Western blot - CNR1 Rabbit pAb (A1447)}

Western blot - CNR1 Rabbit pAb (A1447)

Western blot analysis of extracts of various cell lines, using CNR1 antibody (A1447) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunohistochemistry - CNR1 Rabbit pAb (A1447)}

Immunohistochemistry - CNR1 Rabbit pAb (A1447)

Immunohistochemistry analysis of paraffin-embedded Human gastric cancer using CNR1 antibody (A1447) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CNR1 Rabbit pAb (A1447)}

Immunohistochemistry - CNR1 Rabbit pAb (A1447)

Immunohistochemistry analysis of paraffin-embedded Human stomach using CNR1 antibody (A1447) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1447 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CNR1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CNR1. (Distance between topics and target gene indicate popularity.) CNR1

* Data provided by citexs.com, for reference only.

Publishing research using A1447? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order