Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CLNS1A Rabbit pAb (A16040)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CLNS1A Rabbit pAb (A16040)

Western blot analysis of various lysates using CLNS1A Rabbit pAb (A16040) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - CLNS1A Rabbit pAb (A16040)

Immunohistochemistry analysis of CLNS1A in paraffin-embedded rat kidney using CLNS1A Rabbit pAb (A16040) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CLNS1A Rabbit pAb (A16040)

Immunohistochemistry analysis of CLNS1A in paraffin-embedded human esophageal using CLNS1A Rabbit pAb (A16040) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CLNS1A Rabbit pAb (A16040)

Immunohistochemistry analysis of CLNS1A in paraffin-embedded mouse kidney using CLNS1A Rabbit pAb (A16040) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CLNS1A Rabbit pAb
Catalog No. A16040
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-237 of human CLNS1A (NP_001284.1).
Sequence MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Gene ID 1207
Swiss prot P54105
Synonyms CLCI; ICln; CLNS1B; CLNS1A
Calculated MW 26kDa
Observed MW 38kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HT-29, 293T, DU145, Jurkat, HeLa, Mouse brain
Cellular location Cytoplasm, Nucleus, cytoskeleton, cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CLNS1A Rabbit pAb images

ABclonal:Western blot - CLNS1A Rabbit pAb (A16040)}

Western blot - CLNS1A Rabbit pAb (A16040)

Western blot analysis of various lysates using CLNS1A Rabbit pAb (A16040) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Immunohistochemistry - CLNS1A Rabbit pAb (A16040)}

Immunohistochemistry - CLNS1A Rabbit pAb (A16040)

Immunohistochemistry analysis of CLNS1A in paraffin-embedded rat kidney using CLNS1A Rabbit pAb (A16040) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CLNS1A Rabbit pAb (A16040)}

Immunohistochemistry - CLNS1A Rabbit pAb (A16040)

Immunohistochemistry analysis of CLNS1A in paraffin-embedded human esophageal using CLNS1A Rabbit pAb (A16040) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CLNS1A Rabbit pAb (A16040)}

Immunohistochemistry - CLNS1A Rabbit pAb (A16040)

Immunohistochemistry analysis of CLNS1A in paraffin-embedded mouse kidney using CLNS1A Rabbit pAb (A16040) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A16040 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CLNS1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CLNS1A. (Distance between topics and target gene indicate popularity.) CLNS1A

* Data provided by citexs.com, for reference only.

Publishing research using A16040? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order