Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CLDN7 Rabbit pAb (A2035)

Review (1) Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CLDN7 Rabbit pAb (A2035)

Western blot analysis of lysates from Mouse large intestine using CLDN7 Rabbit pAb(A2035) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:25s.

ABclonal:Immunofluorescence - CLDN7 Rabbit pAb (A2035)

Immunofluorescence analysis of human colon using CLDN7 Rabbit pAb (A2035) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

ABclonal:Immunofluorescence - CLDN7 Rabbit pAb (A2035)

Immunofluorescence analysis of rat large intestine using CLDN7 Rabbit pAb (A2035) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Review
ABclonal: review for CLDN7 Rabbit pAb(A2035)

You may also interested in:

Overview

Product name CLDN7 Rabbit pAb
Catalog No. A2035
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-211 of human CLDN7 (NP_001298.3).
Sequence QWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
Gene ID 1366
Swiss prot O95471
Synonyms CLDN-7; CEPTRL2; CPETRL2; Hs.84359; claudin-1; CLDN7
Calculated MW 22kDa
Observed MW 22kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse large intestine
Cellular location Cell junction, Cell membrane, Lateral cell membrane, Multi-pass membrane protein, tight junction
Customer validation

WB (Mouse colonCanis lupus familiaris, Homo sapiens, Mus musculus)

IHC (Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CLDN7 Rabbit pAb images

ABclonal:Western blot - CLDN7 Rabbit pAb (A2035)}

Western blot - CLDN7 Rabbit pAb (A2035)

Western blot analysis of lysates from Mouse large intestine using CLDN7 Rabbit pAb(A2035) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:25s.
ABclonal:Immunofluorescence - CLDN7 Rabbit pAb (A2035)}

Immunofluorescence - CLDN7 Rabbit pAb (A2035)

Immunofluorescence analysis of human colon using CLDN7 Rabbit pAb (A2035) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.
ABclonal:Immunofluorescence - CLDN7 Rabbit pAb (A2035)}

Immunofluorescence - CLDN7 Rabbit pAb (A2035)

Immunofluorescence analysis of rat large intestine using CLDN7 Rabbit pAb (A2035) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Submit an review for A2035

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2035 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CLDN7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CLDN7. (Distance between topics and target gene indicate popularity.) CLDN7

* Data provided by citexs.com, for reference only.

Publishing research using A2035? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order