Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CITED2 Rabbit pAb (A12831)

Publication (1) Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CITED2 Rabbit pAb (A12831)

Western blot analysis of various lysates using CITED2 Rabbit pAb (A12831) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

You may also interested in:

Overview

Product name CITED2 Rabbit pAb
Catalog No. A12831
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene inhibits transactivation of HIF1A-induced genes by competing with binding of hypoxia-inducible factor 1-alpha to p300-CH1. Mutations in this gene are a cause of cardiac septal defects. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human CITED2 (NP_001161861.2).
Sequence MSGLEMADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC
Gene ID 10370
Swiss prot Q99967
Synonyms ASD8; MRG1; VSD2; MRG-1; P35SRJ; CITED2
Calculated MW 28kDa
Observed MW 28kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples SH-SY5Y, Mouse brain, Rat brain
Cellular location Nucleus
Customer validation

WB (Homo sapiens)

Research Area

CITED2 Rabbit pAb images

ABclonal:Western blot - CITED2 Rabbit pAb (A12831)}

Western blot - CITED2 Rabbit pAb (A12831)

Western blot analysis of various lysates using CITED2 Rabbit pAb (A12831) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

Inquire About This Product

Submit your question about A12831 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CITED2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CITED2. (Distance between topics and target gene indicate popularity.) CITED2

* Data provided by citexs.com, for reference only.

Publishing research using A12831? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order