Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CIAPIN1 Rabbit pAb (A6336)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CIAPIN1 Rabbit pAb (A6336)

Western blot analysis of various lysates using CIAPIN1 Rabbit pAb (A6336) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - CIAPIN1 Rabbit pAb (A6336)

Immunofluorescence analysis of U2OS cells using CIAPIN1 Rabbit pAb (A6336). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - CIAPIN1 Rabbit pAb (A6336)

Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg CIAPIN1 antibody (A6336). Western blot was performed from the immunoprecipitate using CIAPIN1 antibody (A6336) at a dilution of 1:1000.

You may also interested in:

Overview

Product name CIAPIN1 Rabbit pAb
Catalog No. A6336
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-312 of human CIAPIN1 (NP_064709.2).
Sequence MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Gene ID 57019
Swiss prot Q6FI81
Synonyms DRE2; CIAE2; PRO0915; Anamorsin; CIAPIN1
Calculated MW 34kDa
Observed MW 39kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples SKOV3, 293T, HepG2, HeLa, MCF-7, Mouse testis
Cellular location Cytoplasm, Mitochondrion, Mitochondrion intermembrane space, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CIAPIN1 Rabbit pAb images

ABclonal:Western blot - CIAPIN1 Rabbit pAb (A6336)}

Western blot - CIAPIN1 Rabbit pAb (A6336)

Western blot analysis of various lysates using CIAPIN1 Rabbit pAb (A6336) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - CIAPIN1 Rabbit pAb (A6336)}

Immunofluorescence - CIAPIN1 Rabbit pAb (A6336)

Immunofluorescence analysis of U2OS cells using CIAPIN1 Rabbit pAb (A6336). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - CIAPIN1 Rabbit pAb (A6336)}

Immunoprecipitation - CIAPIN1 Rabbit pAb (A6336)

Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg CIAPIN1 antibody (A6336). Western blot was performed from the immunoprecipitate using CIAPIN1 antibody (A6336) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A6336 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CIAPIN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CIAPIN1. (Distance between topics and target gene indicate popularity.) CIAPIN1

* Data provided by citexs.com, for reference only.

Publishing research using A6336? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order