Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | [KO Validated] CDKN2C/p18-INK4C Rabbit mAb |
---|---|
Catalog No. | A8751 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1289 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKN2C/p18-INK4C (P42773). |
---|---|
Sequence | MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE |
Gene ID | 1031 |
Swiss prot | P42773 |
Synonyms | p18; INK4C; p18-INK4C; 4C |
Calculated MW | 18kDa |
Observed MW | 17kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
WB | |
IF/ICC | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence |
Positive samples | HeLa, 293T, NIH/3T3, Mouse lung, Mouse testis, Rat spleen, Rat kidney |
Cellular location | cytoplasm, cytosol, nucleus |
Customer validation | (Hela 、293T 、KYM-1 、NCl-H460 、SKOV-3 、U2-OS) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A8751 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on CDKN2C. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to CDKN2C. (Distance between topics and target gene indicate popularity.) CDKN2C
* Data provided by citexs.com, for reference only.
Publishing research using A8751? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.