Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

KO/KDValidated

Review (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Western blot analysis of extracts of various cell lines, using CDKN2C/p18-INK4C Rabbit mAb (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Western blot analysis of extracts of HepG2 cells, using CDKN2C antibody (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Western blot analysis of extracts from wild type(WT) and CDKN2C knockout (KO) 293T cells, using CDKN2C antibody (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Immunofluorescence analysis of HeLa cells using CDKN2C/p18-INK4C Rabbit mAb (A8751) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for [KO Validated] CDKN2C/p18-INK4C Rabbit mAb(A8751)

You may also interested in:

Overview

Product name [KO Validated] CDKN2C/p18-INK4C Rabbit mAb
Catalog No. A8751
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1289

Background

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKN2C/p18-INK4C (P42773).
Sequence MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE
Gene ID 1031
Swiss prot P42773
Synonyms p18; INK4C; p18-INK4C; 4C
Calculated MW 18kDa
Observed MW 17kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
IF/ICC Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, 293T, NIH/3T3, Mouse lung, Mouse testis, Rat spleen, Rat kidney
Cellular location cytoplasm, cytosol, nucleus
Customer validation

(Hela 、293T 、KYM-1 、NCl-H460 、SKOV-3 、U2-OS)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] CDKN2C/p18-INK4C Rabbit mAb images

ABclonal:Western blot - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)}

Western blot - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Western blot analysis of extracts of various cell lines, using CDKN2C/p18-INK4C Rabbit mAb (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)}

Western blot - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Western blot analysis of extracts of HepG2 cells, using CDKN2C antibody (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)}

Western blot - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Western blot analysis of extracts from wild type(WT) and CDKN2C knockout (KO) 293T cells, using CDKN2C antibody (A8751) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunofluorescence - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)}

Immunofluorescence - [KO Validated] CDKN2C/p18-INK4C Rabbit mAb (A8751)

Immunofluorescence analysis of HeLa cells using CDKN2C/p18-INK4C Rabbit mAb (A8751) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A8751

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A8751 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDKN2C. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDKN2C. (Distance between topics and target gene indicate popularity.) CDKN2C

* Data provided by citexs.com, for reference only.

Publishing research using A8751? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order