Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CDK16 Rabbit pAb (A8140)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunofluorescence - CDK16 Rabbit pAb (A8140)

Immunofluorescence analysis of U2OS cells using CDK16 antibody (A8140) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CDK16 Rabbit pAb
Catalog No. A8140
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells; in exocytosis; and in transport of secretory cargo from the endoplasmic reticulum. This gene is thought to escape X inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 277-496 of human CDK16 (NP_006192.1).
Sequence CHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRLDSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFRVVDTEF
Gene ID 5127
Swiss prot Q00536
Synonyms PCTK1; PCTAIRE; PCTAIRE1; PCTGAIRE; CDK16
Calculated MW 56kDa
Observed MW Refer to figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Peripheral membrane protein, secretory vesicle, synapse, synaptosome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

CDK16 Rabbit pAb images

ABclonal:Immunofluorescence - CDK16 Rabbit pAb (A8140)}

Immunofluorescence - CDK16 Rabbit pAb (A8140)

Immunofluorescence analysis of U2OS cells using CDK16 antibody (A8140) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A8140 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDK16. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDK16. (Distance between topics and target gene indicate popularity.) CDK16

* Data provided by citexs.com, for reference only.

Publishing research using A8140? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order