Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CDC42 Rabbit pAb (A15657)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunofluorescence - CDC42 Rabbit pAb (A15657)

Immunofluorescence analysis of U2OS cells using CDC42 antibody (A15657) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CDC42 Rabbit pAb
Catalog No. A15657
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-186 of human CDC42 (NP_001782.1).
Sequence MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSR
Gene ID 998
Swiss prot P60953
Synonyms TKS; G25K; CDC42Hs; CDC42
Calculated MW 21kDa
Observed MW

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, centrosome, cytoskeleton, microtubule organizing center, spindle

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CDC42 Rabbit pAb images

ABclonal:Immunofluorescence - CDC42 Rabbit pAb (A15657)}

Immunofluorescence - CDC42 Rabbit pAb (A15657)

Immunofluorescence analysis of U2OS cells using CDC42 antibody (A15657) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15657 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDC42. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDC42. (Distance between topics and target gene indicate popularity.) CDC42

* Data provided by citexs.com, for reference only.

Publishing research using A15657? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order