Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CDC25C Rabbit pAb (A11328)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Immunofluorescence - CDC25C Rabbit pAb (A11328)

Immunofluorescence analysis of U2OS cells using CDC25C antibody (A11328). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name CDC25C Rabbit pAb
Catalog No. A11328
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 174-473 of human CDC25C (NP_001781.2).
Sequence PKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Gene ID 995
Swiss prot P30307
Synonyms CDC25; PPP1R60; CDC25C
Calculated MW 53kDa
Observed MW Refer to figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Immunofluorescence    
Positive samples
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CDC25C Rabbit pAb images

ABclonal:Immunofluorescence - CDC25C Rabbit pAb (A11328)}

Immunofluorescence - CDC25C Rabbit pAb (A11328)

Immunofluorescence analysis of U2OS cells using CDC25C antibody (A11328). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11328 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDC25C. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDC25C. (Distance between topics and target gene indicate popularity.) CDC25C

* Data provided by citexs.com, for reference only.

Publishing research using A11328? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order