Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD8A Rabbit pAb (A11856)

Publications (18) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CD8A Rabbit pAb (A11856)

Western blot analysis of extracts of various cell lines, using CD8A antibody (A11856) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - CD8A Rabbit pAb (A11856)

Immunohistochemistry analysis of paraffin-embedded human colon using CD8A Rabbit pAb (A11856) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - CD8A Rabbit pAb (A11856)

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD8A Rabbit pAb (A11856) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name CD8A Rabbit pAb
Catalog No. A11856
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-182 of human CD8A (NP_001759.3).
Sequence SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Gene ID 925
Swiss prot P01732
Synonyms CD8; p32; Leu2; CD8alpha; CD8A
Calculated MW 26kDa
Observed MW 26kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples THP-1, Mouse spleen
Cellular location Cell membrane, Secreted, Single-pass type I membrane protein
Customer validation

IHC (Mus musculus, Rattus norvegicus, Homo sapiens)

WB (Homo sapiens, Mus musculus)

IF (Mus musculus, Homo sapiens)

ELISA (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD8A Rabbit pAb images

ABclonal:Western blot - CD8A Rabbit pAb (A11856)}

Western blot - CD8A Rabbit pAb (A11856)

Western blot analysis of extracts of various cell lines, using CD8A antibody (A11856) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - CD8A Rabbit pAb (A11856)}

Immunohistochemistry - CD8A Rabbit pAb (A11856)

Immunohistochemistry analysis of paraffin-embedded human colon using CD8A Rabbit pAb (A11856) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - CD8A Rabbit pAb (A11856)}

Immunohistochemistry - CD8A Rabbit pAb (A11856)

Immunohistochemistry analysis of paraffin-embedded human tonsil using CD8A Rabbit pAb (A11856) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A11856 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD8A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD8A. (Distance between topics and target gene indicate popularity.) CD8A

* Data provided by citexs.com, for reference only.

Publishing research using A11856? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order