Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CD81 Rabbit pAb (A5270)

Review (1) Publications (20) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - CD81 Rabbit pAb (A5270)

Western blot analysis of Rat brain, using CD81 antibody (A5270) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - CD81 Rabbit pAb (A5270)

Western blot analysis of various lysates, using CD81 Rabbit pAb (A5270) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Hep G2
Exposure time: 20s.

ABclonal:Immunofluorescence - CD81 Rabbit pAb (A5270)

Immunofluorescence analysis of THP-1 and U-937 cells using CD81 Rabbit pAb (A5270) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for CD81 Rabbit pAb(A5270)

You may also interested in:

Overview

Product name CD81 Rabbit pAb
Catalog No. A5270
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 114-199 of human CD81 (NP_004347.1).
Sequence VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS
Gene ID 975
Swiss prot P60033
Synonyms S5.7; CVID6; TAPA1; TSPAN28; CD81
Calculated MW 26kDa
Observed MW 22kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Raji, Mouse brain
Cellular location Membrane, Multi-pass membrane protein
Customer validation

WB (HeLa cellsHomo sapiens, Homo sapiens, Mus musculus, Gallus gallus, Rattus norvegicus, Cynoglossus semilaevis)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD81 Rabbit pAb images

ABclonal:Western blot - CD81 Rabbit pAb (A5270)}

Western blot - CD81 Rabbit pAb (A5270)

Western blot analysis of Rat brain, using CD81 antibody (A5270) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - CD81 Rabbit pAb (A5270)}

Western blot - CD81 Rabbit pAb (A5270)

Western blot analysis of various lysates, using CD81 Rabbit pAb (A5270) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Hep G2
Exposure time: 20s.
ABclonal:Immunofluorescence - CD81 Rabbit pAb (A5270)}

Immunofluorescence - CD81 Rabbit pAb (A5270)

Immunofluorescence analysis of THP-1 and U-937 cells using CD81 Rabbit pAb (A5270) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A5270

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5270 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CD81. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CD81. (Distance between topics and target gene indicate popularity.) CD81

* Data provided by citexs.com, for reference only.

Publishing research using A5270? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order