Publications (34) Datasheet SDS
Tested applications:WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | CD71/Transferrin Receptor Rabbit pAb |
---|---|
Catalog No. | A5865 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71/Transferrin Receptor (NP_003225.2). |
---|---|
Sequence | RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV |
Gene ID | 7037 |
Swiss prot | P02786 |
Synonyms | TFRC; CD71; IMD46; T9; TFR; TFR1; TR; TRFR; p90 |
Calculated MW | 84kDa |
Observed MW | 100KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. May contain BSA. If BSA-free batch required, please contact us. |
Application key | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | HeLa, PC-3 |
Cellular location | Cell membrane, Melanosome, Secreted, Single-pass type II membrane protein |
Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus, Gallus gallus, Danio rerio) IF(Rattus norvegicus) IF(Rattus norvegicus) IHC(Mus musculus) IHC(Mus musculus, Homo sapiens) WB、IF(Mus musculus) |
Submit your question about A5865 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on TFRC. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to TFRC. (Distance between topics and target gene indicate popularity.) TFRC
* Data provided by citexs.com, for reference only.
Publishing research using A5865? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.